Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1174112..1174661 | Replicon | chromosome |
| Accession | NZ_CP115874 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PBS85_RS05490 | Protein ID | WP_023296064.1 |
| Coordinates | 1174112..1174393 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0D7L8S0 |
| Locus tag | PBS85_RS05495 | Protein ID | WP_015571209.1 |
| Coordinates | 1174374..1174661 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBS85_RS05470 (PBS85_05470) | 1169227..1170198 | + | 972 | WP_015571213.1 | LacI family DNA-binding transcriptional regulator | - |
| PBS85_RS05475 (PBS85_05475) | 1170199..1171443 | - | 1245 | WP_015571212.1 | mechanosensitive ion channel family protein | - |
| PBS85_RS05480 (PBS85_05480) | 1171511..1172947 | - | 1437 | WP_032652875.1 | MFS transporter | - |
| PBS85_RS05485 (PBS85_05485) | 1173055..1173924 | + | 870 | WP_045357441.1 | helix-turn-helix transcriptional regulator | - |
| PBS85_RS05490 (PBS85_05490) | 1174112..1174393 | + | 282 | WP_023296064.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PBS85_RS05495 (PBS85_05495) | 1174374..1174661 | + | 288 | WP_015571209.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PBS85_RS05500 (PBS85_05500) | 1174698..1175351 | - | 654 | WP_003858884.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| PBS85_RS05505 (PBS85_05505) | 1175472..1175840 | - | 369 | WP_003858883.1 | MmcQ/YjbR family DNA-binding protein | - |
| PBS85_RS05510 (PBS85_05510) | 1175830..1176420 | - | 591 | WP_003858882.1 | TetR/AcrR family transcriptional regulator | - |
| PBS85_RS05515 (PBS85_05515) | 1176612..1177715 | + | 1104 | WP_045349906.1 | RomA family MBL fold metallo-hydrolase | - |
| PBS85_RS05520 (PBS85_05520) | 1177748..1178089 | + | 342 | WP_032670430.1 | RamA family antibiotic efflux transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10931.84 Da Isoelectric Point: 10.8507
>T267444 WP_023296064.1 NZ_CP115874:1174112-1174393 [Enterobacter hormaechei subsp. steigerwaltii]
MPAGVQAKLIRQLDKLRNNPTVLREPDSKPLPNGLFEIRTVGLIHTRGIYVYQRERTIFLLRVFIKKTQKTPSAELRLAL
KRQQEMLDEQKDY
MPAGVQAKLIRQLDKLRNNPTVLREPDSKPLPNGLFEIRTVGLIHTRGIYVYQRERTIFLLRVFIKKTQKTPSAELRLAL
KRQQEMLDEQKDY
Download Length: 282 bp
Antitoxin
Download Length: 96 a.a. Molecular weight: 10861.41 Da Isoelectric Point: 7.1670
>AT267444 WP_015571209.1 NZ_CP115874:1174374-1174661 [Enterobacter hormaechei subsp. steigerwaltii]
MSKKIIDWDELRAELLSDSEVQASFDAEERKERLREMLAQWRNHAGLTRAQVAERMGVSAPTVSRMEANITRASLDTLTR
YALVCGVKHPQITLY
MSKKIIDWDELRAELLSDSEVQASFDAEERKERLREMLAQWRNHAGLTRAQVAERMGVSAPTVSRMEANITRASLDTLTR
YALVCGVKHPQITLY
Download Length: 288 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|