Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1098649..1099269 Replicon chromosome
Accession NZ_CP115874
Organism Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag PBS85_RS05155 Protein ID WP_015571250.1
Coordinates 1098649..1098867 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag PBS85_RS05160 Protein ID WP_006809850.1
Coordinates 1098895..1099269 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PBS85_RS05125 (PBS85_05125) 1094661..1094921 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
PBS85_RS05130 (PBS85_05130) 1094924..1095064 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
PBS85_RS05135 (PBS85_05135) 1095061..1095771 - 711 WP_033486653.1 GNAT family protein -
PBS85_RS05140 (PBS85_05140) 1095873..1097333 + 1461 WP_271139165.1 PLP-dependent aminotransferase family protein -
PBS85_RS05145 (PBS85_05145) 1097305..1097772 - 468 WP_023296041.1 YlaC family protein -
PBS85_RS05150 (PBS85_05150) 1097889..1098440 - 552 WP_015571251.1 maltose O-acetyltransferase -
PBS85_RS05155 (PBS85_05155) 1098649..1098867 - 219 WP_015571250.1 HHA domain-containing protein Toxin
PBS85_RS05160 (PBS85_05160) 1098895..1099269 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
PBS85_RS05165 (PBS85_05165) 1099780..1102926 - 3147 WP_023296042.1 multidrug efflux RND transporter permease subunit AcrB -
PBS85_RS05170 (PBS85_05170) 1102949..1104142 - 1194 WP_017694395.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T267443 WP_015571250.1 NZ_CP115874:c1098867-1098649 [Enterobacter hormaechei subsp. steigerwaltii]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT267443 WP_006809850.1 NZ_CP115874:c1099269-1098895 [Enterobacter hormaechei subsp. steigerwaltii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References