Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 73694..74356 | Replicon | chromosome |
| Accession | NZ_CP115874 | ||
| Organism | Enterobacter hormaechei subsp. steigerwaltii strain WYTS.MG41 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PBS85_RS00345 | Protein ID | WP_265188151.1 |
| Coordinates | 73958..74356 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | PBS85_RS00340 | Protein ID | WP_047050676.1 |
| Coordinates | 73694..73954 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PBS85_RS00315 (PBS85_00315) | 68911..70032 | - | 1122 | WP_271139042.1 | efflux RND transporter periplasmic adaptor subunit | - |
| PBS85_RS00320 (PBS85_00320) | 70180..70749 | - | 570 | WP_000104919.1 | TetR/AcrR family transcriptional regulator | - |
| PBS85_RS00325 (PBS85_00325) | 70935..71354 | + | 420 | WP_017383664.1 | GNAT family N-acetyltransferase | - |
| PBS85_RS00330 (PBS85_00330) | 71351..71998 | - | 648 | WP_006812486.1 | TetR/AcrR family transcriptional regulator | - |
| PBS85_RS00335 (PBS85_00335) | 72092..73576 | + | 1485 | WP_017693997.1 | MDR family MFS transporter | - |
| PBS85_RS00340 (PBS85_00340) | 73694..73954 | + | 261 | WP_047050676.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| PBS85_RS00345 (PBS85_00345) | 73958..74356 | + | 399 | WP_265188151.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PBS85_RS00350 (PBS85_00350) | 74546..75346 | + | 801 | WP_020480549.1 | lipoprotein NlpA | - |
| PBS85_RS00355 (PBS85_00355) | 75380..76060 | - | 681 | WP_032646710.1 | EAL domain-containing protein | - |
| PBS85_RS00360 (PBS85_00360) | 76136..76756 | - | 621 | WP_015570093.1 | LuxR C-terminal-related transcriptional regulator | - |
| PBS85_RS00365 (PBS85_00365) | 77297..77962 | + | 666 | WP_072134581.1 | LuxR C-terminal-related transcriptional regulator | - |
| PBS85_RS00370 (PBS85_00370) | 77969..79033 | - | 1065 | WP_271139043.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14688.81 Da Isoelectric Point: 5.5038
>T267441 WP_265188151.1 NZ_CP115874:73958-74356 [Enterobacter hormaechei subsp. steigerwaltii]
MLHMLDTNIVSHLVRQHPEVVNRYSQITPEKMCISSVTEAELLYGVAKKQNNKLHETIMEFLKTITVCAWDSEAAATYGE
LRAAMEKKGNVMGDLDQLIAAHAISRGSTIVTNDHAFGMVQDLTVEDWTTVA
MLHMLDTNIVSHLVRQHPEVVNRYSQITPEKMCISSVTEAELLYGVAKKQNNKLHETIMEFLKTITVCAWDSEAAATYGE
LRAAMEKKGNVMGDLDQLIAAHAISRGSTIVTNDHAFGMVQDLTVEDWTTVA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|