Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 16111..16754 | Replicon | plasmid pL4FAA5_2 |
| Accession | NZ_CP115833 | ||
| Organism | Klebsiella pneumoniae strain L4-FAA5 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | PGO70_RS26295 | Protein ID | WP_001044768.1 |
| Coordinates | 16111..16527 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | PGO70_RS26300 | Protein ID | WP_001261287.1 |
| Coordinates | 16524..16754 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGO70_RS26260 (PGO70_26255) | 11205..11459 | - | 255 | WP_016528790.1 | hypothetical protein | - |
| PGO70_RS26265 (PGO70_26260) | 11535..11792 | - | 258 | WP_004098928.1 | hypothetical protein | - |
| PGO70_RS26270 (PGO70_26265) | 11841..12044 | - | 204 | WP_004150739.1 | HHA domain-containing protein | - |
| PGO70_RS26275 (PGO70_26270) | 12105..12599 | - | 495 | WP_016528789.1 | hypothetical protein | - |
| PGO70_RS26280 (PGO70_26275) | 12630..13196 | - | 567 | WP_009654312.1 | hypothetical protein | - |
| PGO70_RS26285 (PGO70_26280) | 13193..13456 | - | 264 | WP_009310051.1 | hypothetical protein | - |
| PGO70_RS26290 (PGO70_26285) | 13811..15949 | + | 2139 | WP_000350635.1 | AAA family ATPase | - |
| PGO70_RS26295 (PGO70_26290) | 16111..16527 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PGO70_RS26300 (PGO70_26295) | 16524..16754 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PGO70_RS26305 (PGO70_26300) | 17060..20179 | + | 3120 | WP_032446663.1 | hypothetical protein | - |
| PGO70_RS26310 (PGO70_26305) | 20442..21575 | + | 1134 | WP_000545983.1 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | clbI / basG | 1..95204 | 95204 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T267414 WP_001044768.1 NZ_CP115833:c16527-16111 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |