Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1077451..1078100 | Replicon | chromosome |
| Accession | NZ_CP115712 | ||
| Organism | Kosakonia pseudosacchari strain RX.G5M8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PF050_RS05165 | Protein ID | WP_086873680.1 |
| Coordinates | 1077451..1077813 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PF050_RS05170 | Protein ID | WP_271069498.1 |
| Coordinates | 1077801..1078100 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF050_RS05140 (PF050_05140) | 1072789..1073793 | - | 1005 | WP_271069495.1 | LacI family DNA-binding transcriptional regulator | - |
| PF050_RS05145 (PF050_05145) | 1073833..1075692 | - | 1860 | WP_271069496.1 | beta-glucoside-specific PTS transporter subunit IIABC | - |
| PF050_RS05150 (PF050_05150) | 1075924..1076238 | + | 315 | WP_097401500.1 | antibiotic biosynthesis monooxygenase | - |
| PF050_RS05155 (PF050_05155) | 1076240..1076632 | + | 393 | WP_271069497.1 | amino acid-binding protein | - |
| PF050_RS05160 (PF050_05160) | 1076629..1077336 | + | 708 | WP_271070112.1 | winged helix-turn-helix domain-containing protein | - |
| PF050_RS05165 (PF050_05165) | 1077451..1077813 | + | 363 | WP_086873680.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PF050_RS05170 (PF050_05170) | 1077801..1078100 | + | 300 | WP_271069498.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PF050_RS05175 (PF050_05175) | 1078106..1078540 | + | 435 | WP_271069499.1 | hypothetical protein | - |
| PF050_RS05180 (PF050_05180) | 1078681..1079448 | + | 768 | WP_271069500.1 | isocitrate lyase/phosphoenolpyruvate mutase family protein | - |
| PF050_RS05185 (PF050_05185) | 1079432..1080484 | + | 1053 | WP_271069501.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| PF050_RS05190 (PF050_05190) | 1080560..1082388 | - | 1829 | Protein_1017 | glycoside hydrolase family 15 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14143.30 Da Isoelectric Point: 9.7915
>T267325 WP_086873680.1 NZ_CP115712:1077451-1077813 [Kosakonia pseudosacchari]
MWQVITTERFDVWFSIQPERLQDEILAVFRILSEFGPQLGRPYVDTVKGSTYSNMKELRIQYAGSPVRAFFAFDSTRRAI
VLCAGDKTGVNEKRFYKEMIKIADAEFRKHMRNKELTWQP
MWQVITTERFDVWFSIQPERLQDEILAVFRILSEFGPQLGRPYVDTVKGSTYSNMKELRIQYAGSPVRAFFAFDSTRRAI
VLCAGDKTGVNEKRFYKEMIKIADAEFRKHMRNKELTWQP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|