Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1142441..1143061 | Replicon | chromosome |
| Accession | NZ_CP115689 | ||
| Organism | Enterobacter hormaechei strain 2020CK-00204 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | PF325_RS05420 | Protein ID | WP_015571250.1 |
| Coordinates | 1142441..1142659 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | PF325_RS05425 | Protein ID | WP_006809850.1 |
| Coordinates | 1142687..1143061 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF325_RS05390 (PF325_05390) | 1138453..1138713 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| PF325_RS05395 (PF325_05395) | 1138716..1138856 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| PF325_RS05400 (PF325_05400) | 1138853..1139563 | - | 711 | WP_017383207.1 | GNAT family protein | - |
| PF325_RS05405 (PF325_05405) | 1139665..1141125 | + | 1461 | WP_172746071.1 | PLP-dependent aminotransferase family protein | - |
| PF325_RS05410 (PF325_05410) | 1141097..1141564 | - | 468 | WP_015571252.1 | YlaC family protein | - |
| PF325_RS05415 (PF325_05415) | 1141681..1142232 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
| PF325_RS05420 (PF325_05420) | 1142441..1142659 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| PF325_RS05425 (PF325_05425) | 1142687..1143061 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| PF325_RS05430 (PF325_05430) | 1143572..1146718 | - | 3147 | WP_271040581.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| PF325_RS05435 (PF325_05435) | 1146741..1147934 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T267267 WP_015571250.1 NZ_CP115689:c1142659-1142441 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT267267 WP_006809850.1 NZ_CP115689:c1143061-1142687 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |