Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 2842652..2843217 | Replicon | chromosome |
| Accession | NZ_CP115671 | ||
| Organism | Brevundimonas vesicularis strain PL22-8A | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | PFY01_RS14440 | Protein ID | WP_271041797.1 |
| Coordinates | 2842897..2843217 (+) | Length | 107 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1H1D608 |
| Locus tag | PFY01_RS14435 | Protein ID | WP_045809783.1 |
| Coordinates | 2842652..2842897 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PFY01_RS14415 (PFY01_14415) | 2837897..2838616 | + | 720 | WP_271041793.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| PFY01_RS14420 (PFY01_14420) | 2838818..2840179 | + | 1362 | WP_271041794.1 | glutamate--cysteine ligase | - |
| PFY01_RS14425 (PFY01_14425) | 2840176..2840913 | - | 738 | WP_271041795.1 | hypothetical protein | - |
| PFY01_RS14430 (PFY01_14430) | 2841026..2842597 | + | 1572 | WP_271041796.1 | ATP-binding protein | - |
| PFY01_RS14435 (PFY01_14435) | 2842652..2842897 | + | 246 | WP_045809783.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| PFY01_RS14440 (PFY01_14440) | 2842897..2843217 | + | 321 | WP_271041797.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PFY01_RS14445 (PFY01_14445) | 2843214..2843963 | + | 750 | WP_271041798.1 | DUF72 domain-containing protein | - |
| PFY01_RS14450 (PFY01_14450) | 2844041..2845102 | + | 1062 | WP_066549790.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| PFY01_RS14455 (PFY01_14455) | 2845246..2845971 | + | 726 | WP_066549787.1 | acetoacetyl-CoA reductase | - |
| PFY01_RS14460 (PFY01_14460) | 2846072..2846788 | + | 717 | WP_271043074.1 | DUF4908 domain-containing protein | - |
| PFY01_RS14465 (PFY01_14465) | 2846785..2847513 | - | 729 | WP_271041799.1 | hydroxyacylglutathione hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12006.51 Da Isoelectric Point: 4.8728
>T267251 WP_271041797.1 NZ_CP115671:2842897-2843217 [Brevundimonas vesicularis]
MLRLSRAARADLQQVYLQGLELFGSRQADDYIEGLFAKLDLLADFPRLGAARPELSADAHVIFYKSHAILYRIDDADMFV
RRIRHALEDWQSDAPGVGSSDERSEP
MLRLSRAARADLQQVYLQGLELFGSRQADDYIEGLFAKLDLLADFPRLGAARPELSADAHVIFYKSHAILYRIDDADMFV
RRIRHALEDWQSDAPGVGSSDERSEP
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|