Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2731820..2732499 | Replicon | chromosome |
| Accession | NZ_CP115632 | ||
| Organism | Acinetobacter baumannii strain 2022CK-00063 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | PF552_RS13070 | Protein ID | WP_000838146.1 |
| Coordinates | 2732317..2732499 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | PF552_RS13065 | Protein ID | WP_000966688.1 |
| Coordinates | 2731820..2732224 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF552_RS13035 (PF552_13035) | 2728832..2729824 | - | 993 | WP_000835645.1 | KilA-N domain-containing protein | - |
| PF552_RS13040 (PF552_13040) | 2729821..2729976 | - | 156 | WP_001103649.1 | Arc family DNA-binding protein | - |
| PF552_RS13045 (PF552_13045) | 2730099..2730338 | + | 240 | WP_000763623.1 | Arc family DNA-binding protein | - |
| PF552_RS13050 (PF552_13050) | 2730387..2731181 | - | 795 | WP_000720608.1 | hypothetical protein | - |
| PF552_RS13055 (PF552_13055) | 2731213..2731536 | - | 324 | WP_000523922.1 | DUF4236 domain-containing protein | - |
| PF552_RS13060 (PF552_13060) | 2731545..2731721 | - | 177 | WP_014466185.1 | hypothetical protein | - |
| PF552_RS13065 (PF552_13065) | 2731820..2732224 | - | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PF552_RS13070 (PF552_13070) | 2732317..2732499 | - | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PF552_RS13075 (PF552_13075) | 2732825..2733334 | - | 510 | WP_031959991.1 | hypothetical protein | - |
| PF552_RS13080 (PF552_13080) | 2733405..2734322 | - | 918 | WP_031959988.1 | phage tail tube protein | - |
| PF552_RS13085 (PF552_13085) | 2734418..2735389 | - | 972 | WP_031959985.1 | hypothetical protein | - |
| PF552_RS13090 (PF552_13090) | 2735389..2735739 | - | 351 | WP_031959983.1 | hypothetical protein | - |
| PF552_RS13095 (PF552_13095) | 2735836..2736357 | - | 522 | WP_031959981.1 | SH3 domain-containing protein | - |
| PF552_RS13100 (PF552_13100) | 2736466..2736684 | - | 219 | WP_001277696.1 | hypothetical protein | - |
| PF552_RS13105 (PF552_13105) | 2736686..2737129 | - | 444 | WP_078207566.1 | hypothetical protein | - |
| PF552_RS13110 (PF552_13110) | 2737086..2737454 | - | 369 | WP_031959977.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2715633..2763937 | 48304 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T267202 WP_000838146.1 NZ_CP115632:c2732499-2732317 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT267202 WP_000966688.1 NZ_CP115632:c2732224-2731820 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|