Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 4312756..4313444 Replicon chromosome
Accession NZ_CP115551
Organism Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag PEE20_RS21665 Protein ID WP_260776419.1
Coordinates 4312756..4313100 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A5V0UJE1
Locus tag PEE20_RS21670 Protein ID WP_001136058.1
Coordinates 4313115..4313444 (-) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PEE20_RS21635 (4308329) 4308329..4309045 + 717 WP_000532939.1 YebC/PmpR family DNA-binding transcriptional regulator -
PEE20_RS21640 (4309525) 4309525..4310400 - 876 WP_270805137.1 HNH endonuclease -
PEE20_RS21645 (4310835) 4310835..4311143 - 309 WP_001199743.1 CcdB family protein -
PEE20_RS21650 (4311146) 4311146..4311385 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin -
PEE20_RS21655 (4311494) 4311494..4311742 - 249 WP_023203347.1 ribbon-helix-helix protein, CopG family -
PEE20_RS21660 (4311807) 4311807..4312640 - 834 WP_270805142.1 DUF4942 domain-containing protein -
PEE20_RS21665 (4312756) 4312756..4313100 - 345 WP_260776419.1 toxin Toxin
PEE20_RS21670 (4313115) 4313115..4313444 - 330 WP_001136058.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PEE20_RS21675 (4313507) 4313507..4314007 - 501 WP_270805144.1 DNA repair protein RadC -
PEE20_RS21680 (4314020) 4314020..4314838 - 819 WP_270805146.1 DUF932 domain-containing protein -
PEE20_RS21685 (4314980) 4314980..4315438 - 459 WP_000502121.1 IS200/IS605-like element IS200F family transposase -
PEE20_RS21690 (4315395) 4315395..4315577 - 183 WP_000431187.1 hypothetical protein -
PEE20_RS21695 (4315651) 4315651..4315896 - 246 WP_000082136.1 DUF905 domain-containing protein -
PEE20_RS21700 (4315971) 4315971..4316885 - 915 WP_270805148.1 hypothetical protein -
PEE20_RS21705 (4316950) 4316950..4317153 - 204 WP_023137300.1 hypothetical protein -
PEE20_RS21710 (4317170) 4317170..4317382 - 213 WP_270805149.1 hypothetical protein -
PEE20_RS21715 (4317389) 4317389..4318102 - 714 WP_270805151.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4301681..4339192 37511
- flank IS/Tn - - 4314980..4315438 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(14-110)

Antitoxin

Antitoxin CbeA

(10-108)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13054.00 Da        Isoelectric Point: 9.5686

>T267184 WP_260776419.1 NZ_CP115551:c4313100-4312756 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MQNVLSLPSPAATPSRLSPVEAWRKLLSYLLQRHYGLELNDTPFCDDSVIQEHINAGVTLADAVNFLVEKYELVRIDRKG
FSWQEPSPYLRAVDILRARQVTGLLRRRRNLAAH

Download         Length: 345 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12067.62 Da        Isoelectric Point: 6.4672

>AT267184 WP_001136058.1 NZ_CP115551:c4313444-4313115 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MPQNQPSAPVWGLRSDITPSFGARLVQEGCRLHFLADRASLCGNFTPEQLQTLEVTFPQFVKQLESVLKSGALDPRQPHR
HSITLNGLTCEADTNGSHGYVYLTIYPAE

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5V0UJE1

References