Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 873852..874477 | Replicon | chromosome |
| Accession | NZ_CP115551 | ||
| Organism | Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PEE20_RS04300 | Protein ID | WP_151117435.1 |
| Coordinates | 874079..874477 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | C0PXM4 |
| Locus tag | PEE20_RS04295 | Protein ID | WP_000557545.1 |
| Coordinates | 873852..874079 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PEE20_RS04265 (868865) | 868865..870382 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
| PEE20_RS04270 (870458) | 870458..871003 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| PEE20_RS04275 (871268) | 871268..872026 | + | 759 | WP_000244328.1 | amidase activator ActS | - |
| PEE20_RS04285 (872311) | 872311..873117 | - | 807 | WP_001574939.1 | DUF1460 domain-containing protein | - |
| PEE20_RS04290 (873392) | 873392..873643 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| PEE20_RS04295 (873852) | 873852..874079 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PEE20_RS04300 (874079) | 874079..874477 | + | 399 | WP_151117435.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PEE20_RS04305 (875288) | 875288..875824 | + | 537 | WP_001038502.1 | STM3031 family outer membrane protein | - |
| PEE20_RS04310 (875871) | 875871..876503 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| PEE20_RS04315 (877222) | 877222..877809 | + | 588 | WP_270805634.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 872311..900045 | 27734 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15051.46 Da Isoelectric Point: 7.7785
>T267174 WP_151117435.1 NZ_CP115551:874079-874477 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAIVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAIVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|