Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-stbD/ParE(toxin) |
Location | 2605859..2606429 | Replicon | chromosome |
Accession | NZ_CP114976 | ||
Organism | Denitrificimonas caeni strain CE14 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | O6P33_RS12140 | Protein ID | WP_269818035.1 |
Coordinates | 2605859..2606140 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | - |
Locus tag | O6P33_RS12145 | Protein ID | WP_269818036.1 |
Coordinates | 2606142..2606429 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6P33_RS12120 (O6P33_12120) | 2601694..2602650 | - | 957 | WP_269819529.1 | signal peptide peptidase SppA | - |
O6P33_RS12125 (O6P33_12125) | 2602743..2603423 | - | 681 | WP_269818032.1 | HAD-IA family hydrolase | - |
O6P33_RS12130 (O6P33_12130) | 2603505..2604641 | - | 1137 | WP_269818033.1 | Do family serine endopeptidase AlgW | - |
O6P33_RS12135 (O6P33_12135) | 2604835..2605593 | + | 759 | WP_269818034.1 | Nif3-like dinuclear metal center hexameric protein | - |
O6P33_RS12140 (O6P33_12140) | 2605859..2606140 | - | 282 | WP_269818035.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O6P33_RS12145 (O6P33_12145) | 2606142..2606429 | - | 288 | WP_269818036.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
O6P33_RS12150 (O6P33_12150) | 2607389..2608306 | + | 918 | WP_269818037.1 | sulfate adenylyltransferase subunit CysD | - |
O6P33_RS12155 (O6P33_12155) | 2608319..2610214 | + | 1896 | WP_269818038.1 | sulfate adenylyltransferase subunit CysN | - |
O6P33_RS12160 (O6P33_12160) | 2610370..2611293 | - | 924 | WP_269818039.1 | ChaN family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11025.13 Da Isoelectric Point: 11.0986
>T267045 WP_269818035.1 NZ_CP114976:c2606140-2605859 [Denitrificimonas caeni]
MYQLGFGRQARKEWDKLSKPIQLQFALKLKERLKNPHVKKDALSGMPHCYKIKLRSIGFRLVYQVLDQTLVITVVAVGKR
ERNEVYRKARERL
MYQLGFGRQARKEWDKLSKPIQLQFALKLKERLKNPHVKKDALSGMPHCYKIKLRSIGFRLVYQVLDQTLVITVVAVGKR
ERNEVYRKARERL
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|