Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2717543..2718374 | Replicon | chromosome |
| Accession | NZ_CP114895 | ||
| Organism | Escherichia coli strain CM56 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | O6106_RS13505 | Protein ID | WP_000854814.1 |
| Coordinates | 2718000..2718374 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | O6106_RS13500 | Protein ID | WP_001285584.1 |
| Coordinates | 2717543..2717911 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6106_RS13485 (2715210) | 2715210..2716742 | + | 1533 | WP_001350525.1 | protein YeeR | - |
| O6106_RS13490 (2716739) | 2716739..2717185 | + | 447 | WP_000187523.1 | RadC family protein | - |
| O6106_RS13495 (2717248) | 2717248..2717469 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| O6106_RS13500 (2717543) | 2717543..2717911 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| O6106_RS13505 (2718000) | 2718000..2718374 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| O6106_RS13510 (2718371) | 2718371..2718565 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| O6106_RS13515 (2718611) | 2718611..2718691 | + | 81 | Protein_2619 | hypothetical protein | - |
| O6106_RS13520 (2718980) | 2718980..2719108 | - | 129 | Protein_2620 | transposase domain-containing protein | - |
| O6106_RS13525 (2719228) | 2719228..2719362 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| O6106_RS13530 (2719463) | 2719463..2719792 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| O6106_RS13535 (2719964) | 2719964..2721022 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| O6106_RS13540 (2721220) | 2721220..2721693 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| O6106_RS13545 (2721812) | 2721812..2722978 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T267007 WP_000854814.1 NZ_CP114895:2718000-2718374 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT267007 WP_001285584.1 NZ_CP114895:2717543-2717911 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |