Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1428774..1429605 | Replicon | chromosome |
| Accession | NZ_CP114894 | ||
| Organism | Escherichia coli strain CM19 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | O6X69_RS07205 | Protein ID | WP_000854814.1 |
| Coordinates | 1429231..1429605 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | O6X69_RS07200 | Protein ID | WP_001285584.1 |
| Coordinates | 1428774..1429142 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6X69_RS07185 (1426441) | 1426441..1427973 | + | 1533 | WP_001350525.1 | protein YeeR | - |
| O6X69_RS07190 (1427970) | 1427970..1428416 | + | 447 | WP_000187523.1 | RadC family protein | - |
| O6X69_RS07195 (1428479) | 1428479..1428700 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| O6X69_RS07200 (1428774) | 1428774..1429142 | + | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| O6X69_RS07205 (1429231) | 1429231..1429605 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| O6X69_RS07210 (1429602) | 1429602..1429796 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| O6X69_RS07215 (1429842) | 1429842..1429922 | + | 81 | Protein_1404 | hypothetical protein | - |
| O6X69_RS07220 (1430211) | 1430211..1430339 | - | 129 | Protein_1405 | transposase domain-containing protein | - |
| O6X69_RS07225 (1430459) | 1430459..1430593 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| O6X69_RS07230 (1430694) | 1430694..1431023 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| O6X69_RS07235 (1431195) | 1431195..1432253 | - | 1059 | WP_001200891.1 | FUSC family protein | - |
| O6X69_RS07240 (1432451) | 1432451..1432924 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| O6X69_RS07245 (1433043) | 1433043..1434209 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T266974 WP_000854814.1 NZ_CP114894:1429231-1429605 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT266974 WP_001285584.1 NZ_CP114894:1428774-1429142 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |