Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1439070..1439727 | Replicon | chromosome |
| Accession | NZ_CP114796 | ||
| Organism | Providencia sp. 21OH12SH02B-Prov | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | O7C57_RS06825 | Protein ID | WP_163860914.1 |
| Coordinates | 1439317..1439727 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | O7C57_RS06820 | Protein ID | WP_154624313.1 |
| Coordinates | 1439070..1439336 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O7C57_RS06805 (O7C57_06805) | 1434222..1437098 | + | 2877 | WP_269723798.1 | aminomethyl-transferring glycine dehydrogenase | - |
| O7C57_RS06810 (O7C57_06810) | 1437195..1437815 | - | 621 | WP_154624315.1 | HD domain-containing protein | - |
| O7C57_RS06815 (O7C57_06815) | 1437827..1438816 | - | 990 | WP_154624314.1 | tRNA-modifying protein YgfZ | - |
| O7C57_RS06820 (O7C57_06820) | 1439070..1439336 | + | 267 | WP_154624313.1 | FAD assembly factor SdhE | Antitoxin |
| O7C57_RS06825 (O7C57_06825) | 1439317..1439727 | + | 411 | WP_163860914.1 | protein YgfX | Toxin |
| O7C57_RS06830 (O7C57_06830) | 1439772..1440290 | - | 519 | WP_154624312.1 | flavodoxin FldB | - |
| O7C57_RS06835 (O7C57_06835) | 1440375..1441298 | + | 924 | WP_154624329.1 | site-specific tyrosine recombinase XerD | - |
| O7C57_RS06840 (O7C57_06840) | 1441318..1442019 | + | 702 | WP_154624311.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| O7C57_RS06845 (O7C57_06845) | 1442029..1443762 | + | 1734 | WP_196713356.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15375.24 Da Isoelectric Point: 10.8779
>T266839 WP_163860914.1 NZ_CP114796:1439317-1439727 [Providencia sp. 21OH12SH02B-Prov]
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|