Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 455311..455964 | Replicon | chromosome |
| Accession | NZ_CP114381 | ||
| Organism | Acinetobacter baumannii strain AB6870155 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | B0V6V2 |
| Locus tag | NH10_RS02195 | Protein ID | WP_000931890.1 |
| Coordinates | 455575..455964 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | NH10_RS02190 | Protein ID | WP_001288210.1 |
| Coordinates | 455311..455568 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NH10_RS02170 (NH10_000420) | 450827..451834 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| NH10_RS02175 (NH10_000421) | 451853..452230 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| NH10_RS02180 (NH10_000422) | 452411..453901 | + | 1491 | WP_000415133.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NH10_RS02185 (NH10_000423) | 453951..455123 | - | 1173 | WP_001190546.1 | acyl-CoA dehydrogenase family protein | - |
| NH10_RS02190 (NH10_000424) | 455311..455568 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| NH10_RS02195 (NH10_000425) | 455575..455964 | + | 390 | WP_000931890.1 | membrane protein | Toxin |
| NH10_RS02200 (NH10_000427) | 456734..457819 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| NH10_RS02205 (NH10_000428) | 457897..458463 | + | 567 | WP_000651536.1 | rhombosortase | - |
| NH10_RS02210 (NH10_000429) | 458651..460846 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15649.98 Da Isoelectric Point: 10.4623
>T266655 WP_000931890.1 NZ_CP114381:455575-455964 [Acinetobacter baumannii]
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MLNHLNFKLKYSRFSIIFQFFIGLSLAILFYQLMPLLWWLVVISLLFISFIFFLKRPQLAKIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1A4U0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BQM7 |