Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5489440..5490065 | Replicon | chromosome |
| Accession | NZ_CP114324 | ||
| Organism | Klebsiella variicola strain 2022CK-00503 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A1F2M041 |
| Locus tag | OEE48_RS26540 | Protein ID | WP_008807903.1 |
| Coordinates | 5489440..5489823 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | OEE48_RS26545 | Protein ID | WP_004150355.1 |
| Coordinates | 5489823..5490065 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEE48_RS26525 (OEE48_26520) | 5486806..5487708 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| OEE48_RS26530 (OEE48_26525) | 5487705..5488340 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OEE48_RS26535 (OEE48_26530) | 5488337..5489266 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| OEE48_RS26540 (OEE48_26535) | 5489440..5489823 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OEE48_RS26545 (OEE48_26540) | 5489823..5490065 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| OEE48_RS26550 (OEE48_26545) | 5490270..5491187 | + | 918 | WP_064171510.1 | alpha/beta hydrolase | - |
| OEE48_RS26555 (OEE48_26550) | 5491201..5492142 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
| OEE48_RS26560 (OEE48_26555) | 5492187..5492624 | - | 438 | WP_008807906.1 | D-aminoacyl-tRNA deacylase | - |
| OEE48_RS26565 (OEE48_26560) | 5492621..5493481 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
| OEE48_RS26570 (OEE48_26565) | 5493475..5494074 | - | 600 | WP_008807908.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T266548 WP_008807903.1 NZ_CP114324:c5489823-5489440 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2M041 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |