Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-RelB
Location 1236823..1237321 Replicon chromosome
Accession NZ_CP114277
Organism Rickettsia rickettsii strain RMSFvaccine

Toxin (Protein)


Gene name relE Uniprot ID A0A0H3AWA1
Locus tag O3C91_RS06940 Protein ID WP_012151451.1
Coordinates 1237178..1237321 (+) Length 48 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID H8LNX5
Locus tag O3C91_RS06935 Protein ID WP_012151450.1
Coordinates 1236823..1237086 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O3C91_RS06895 1232073..1232189 + 117 WP_080508248.1 palindromic element RPE1 domain-containing protein -
O3C91_RS06900 1232241..1232936 - 696 WP_012151442.1 TIGR02281 family clan AA aspartic protease -
O3C91_RS06905 1232997..1233215 - 219 WP_012151443.1 serine hydrolase -
O3C91_RS06910 1233855..1233989 - 135 WP_012151446.1 hypothetical protein -
O3C91_RS06915 1234133..1234372 - 240 WP_012151447.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
O3C91_RS06920 1234577..1235299 - 723 WP_010977895.1 amino acid ABC transporter ATP-binding protein -
O3C91_RS06925 1235303..1236067 - 765 WP_012151448.1 MBL fold metallo-hydrolase -
O3C91_RS06930 1236082..1236729 + 648 WP_012151449.1 phosphatase PAP2 family protein -
O3C91_RS06935 1236823..1237086 + 264 WP_012151450.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
O3C91_RS06940 1237178..1237321 + 144 WP_012151451.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
O3C91_RS06945 1237457..1238539 + 1083 WP_014362438.1 LptF/LptG family permease -
O3C91_RS06950 1238545..1239009 - 465 WP_012151453.1 DNA polymerase III subunit chi -
O3C91_RS06960 1239209..1240354 - 1146 WP_012151455.1 succinyl-diaminopimelate desuccinylase -
O3C91_RS06965 1240358..1240612 - 255 WP_012151456.1 restriction endonuclease subunit S -
O3C91_RS06970 1240916..1241044 - 129 WP_230453655.1 hypothetical protein -
O3C91_RS06975 1241112..1241303 - 192 WP_014362439.1 hypothetical protein -
O3C91_RS06980 1241352..1241810 - 459 WP_012151458.1 N-6 DNA methylase -
O3C91_RS06985 1241880..1242011 - 132 WP_252081322.1 SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-45)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-83)


Sequences

Toxin        


Download         Length: 48 a.a.        Molecular weight: 5357.17 Da        Isoelectric Point: 6.4361

>T266430 WP_012151451.1 NZ_CP114277:1237178-1237321 [Rickettsia rickettsii]
MRDHALIGNWKDCRDCHIKADLVLIYRKPDADTLELIQLGSNSTLGF

Download         Length: 144 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9516.03 Da        Isoelectric Point: 5.0916

>AT266430 WP_012151450.1 NZ_CP114277:1236823-1237086 [Rickettsia rickettsii]
MSADSIVRARINEDVKEEAALVLAAMGLTLSDAVRMLLFRVAREKALPFEPLIPNDETIKAMKAARSGKLVHVGNINNLL
SDLNEND

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3AWA1

Antitoxin

Source ID Structure
AlphaFold DB H8LNX5

References