Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 5421..6022 Replicon plasmid pNJS001-1
Accession NZ_CP114131
Organism Escherichia coli strain NJS001

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag N0F11_RS25300 Protein ID WP_259897169.1
Coordinates 5421..5801 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag N0F11_RS25305 Protein ID WP_001190712.1
Coordinates 5801..6022 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0F11_RS25270 (N0F11_25270) 833..997 - 165 WP_269134765.1 hypothetical protein -
N0F11_RS25275 (N0F11_25275) 1576..2346 - 771 WP_269134766.1 hypothetical protein -
N0F11_RS25280 (N0F11_25280) 2346..3539 - 1194 WP_063075113.1 hypothetical protein -
N0F11_RS25285 (N0F11_25285) 3625..4077 - 453 WP_001326849.1 late promoter-activating protein -
N0F11_RS25290 (N0F11_25290) 4166..5209 - 1044 WP_032192894.1 DUF968 domain-containing protein -
N0F11_RS25295 (N0F11_25295) 5237..5416 - 180 WP_000113018.1 hypothetical protein -
N0F11_RS25300 (N0F11_25300) 5421..5801 - 381 WP_259897169.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N0F11_RS25305 (N0F11_25305) 5801..6022 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N0F11_RS25310 (N0F11_25310) 6095..6484 - 390 WP_000506726.1 S24 family peptidase -
N0F11_RS25315 (N0F11_25315) 6607..6858 - 252 WP_032153798.1 DNA polymerase III subunit theta -
N0F11_RS25320 (N0F11_25320) 7173..7430 - 258 WP_176225827.1 hypothetical protein -
N0F11_RS25325 (N0F11_25325) 7703..8344 - 642 WP_176225828.1 hypothetical protein -
N0F11_RS25330 (N0F11_25330) 8326..8700 - 375 WP_000988655.1 hypothetical protein -
N0F11_RS25335 (N0F11_25335) 8707..9000 - 294 WP_176225830.1 hypothetical protein -
N0F11_RS25340 (N0F11_25340) 9179..9412 - 234 WP_000517421.1 hypothetical protein -
N0F11_RS25345 (N0F11_25345) 9498..9758 - 261 WP_063074809.1 hypothetical protein -
N0F11_RS25350 (N0F11_25350) 9755..10666 - 912 WP_250844976.1 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - cnf1 1..116902 116902


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(4-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13489.16 Da        Isoelectric Point: 4.8616

>T266317 WP_259897169.1 NZ_CP114131:c5801-5421 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGGAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT266317 WP_001190712.1 NZ_CP114131:c6022-5801 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References