Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 5421..6022 | Replicon | plasmid pNJS001-1 |
| Accession | NZ_CP114131 | ||
| Organism | Escherichia coli strain NJS001 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | N0F11_RS25300 | Protein ID | WP_259897169.1 |
| Coordinates | 5421..5801 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | N0F11_RS25305 | Protein ID | WP_001190712.1 |
| Coordinates | 5801..6022 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N0F11_RS25270 (N0F11_25270) | 833..997 | - | 165 | WP_269134765.1 | hypothetical protein | - |
| N0F11_RS25275 (N0F11_25275) | 1576..2346 | - | 771 | WP_269134766.1 | hypothetical protein | - |
| N0F11_RS25280 (N0F11_25280) | 2346..3539 | - | 1194 | WP_063075113.1 | hypothetical protein | - |
| N0F11_RS25285 (N0F11_25285) | 3625..4077 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| N0F11_RS25290 (N0F11_25290) | 4166..5209 | - | 1044 | WP_032192894.1 | DUF968 domain-containing protein | - |
| N0F11_RS25295 (N0F11_25295) | 5237..5416 | - | 180 | WP_000113018.1 | hypothetical protein | - |
| N0F11_RS25300 (N0F11_25300) | 5421..5801 | - | 381 | WP_259897169.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| N0F11_RS25305 (N0F11_25305) | 5801..6022 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| N0F11_RS25310 (N0F11_25310) | 6095..6484 | - | 390 | WP_000506726.1 | S24 family peptidase | - |
| N0F11_RS25315 (N0F11_25315) | 6607..6858 | - | 252 | WP_032153798.1 | DNA polymerase III subunit theta | - |
| N0F11_RS25320 (N0F11_25320) | 7173..7430 | - | 258 | WP_176225827.1 | hypothetical protein | - |
| N0F11_RS25325 (N0F11_25325) | 7703..8344 | - | 642 | WP_176225828.1 | hypothetical protein | - |
| N0F11_RS25330 (N0F11_25330) | 8326..8700 | - | 375 | WP_000988655.1 | hypothetical protein | - |
| N0F11_RS25335 (N0F11_25335) | 8707..9000 | - | 294 | WP_176225830.1 | hypothetical protein | - |
| N0F11_RS25340 (N0F11_25340) | 9179..9412 | - | 234 | WP_000517421.1 | hypothetical protein | - |
| N0F11_RS25345 (N0F11_25345) | 9498..9758 | - | 261 | WP_063074809.1 | hypothetical protein | - |
| N0F11_RS25350 (N0F11_25350) | 9755..10666 | - | 912 | WP_250844976.1 | DUF551 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cnf1 | 1..116902 | 116902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13489.16 Da Isoelectric Point: 4.8616
>T266317 WP_259897169.1 NZ_CP114131:c5801-5421 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGGAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGGAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|