Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2843240..2844035 Replicon chromosome
Accession NZ_CP114130
Organism Escherichia coli strain NJS001

Toxin (Protein)


Gene name yeeV Uniprot ID B7UP43
Locus tag N0F11_RS14490 Protein ID WP_000854914.1
Coordinates 2843240..2843614 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0B0VS41
Locus tag N0F11_RS14495 Protein ID WP_001280954.1
Coordinates 2843661..2844035 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N0F11_RS14450 (2838244) 2838244..2838735 - 492 WP_001301587.1 DUF1097 domain-containing protein -
N0F11_RS14455 (2838837) 2838837..2839391 - 555 WP_001001917.1 molecular chaperone YcdY -
N0F11_RS14460 (2839415) 2839415..2840152 - 738 WP_000283664.1 zinc-binding phosphatase -
N0F11_RS14465 (2840207) 2840207..2841145 - 939 WP_000351284.1 glyoxylate/hydroxypyruvate reductase GhrA -
N0F11_RS14475 (2841616) 2841616..2842458 - 843 WP_128484537.1 DUF4942 domain-containing protein -
N0F11_RS14480 (2842543) 2842543..2842740 - 198 WP_000839282.1 DUF957 domain-containing protein -
N0F11_RS14485 (2842752) 2842752..2843243 - 492 WP_000976853.1 DUF5983 family protein -
N0F11_RS14490 (2843240) 2843240..2843614 - 375 WP_000854914.1 TA system toxin CbtA family protein Toxin
N0F11_RS14495 (2843661) 2843661..2844035 - 375 WP_001280954.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N0F11_RS14500 (2844198) 2844198..2844419 - 222 WP_001220314.1 DUF987 domain-containing protein -
N0F11_RS14505 (2844482) 2844482..2844958 - 477 WP_001186738.1 RadC family protein -
N0F11_RS14510 (2844974) 2844974..2845459 - 486 WP_000214398.1 antirestriction protein -
N0F11_RS14515 (2845550) 2845550..2846368 - 819 WP_001234682.1 DUF932 domain-containing protein -
N0F11_RS14520 (2846708) 2846708..2847778 - 1071 WP_000102669.1 patatin-like phospholipase family protein -
N0F11_RS14525 (2847775) 2847775..2848678 - 904 Protein_2848 diguanylate cyclase regulator RdcB family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14117.17 Da        Isoelectric Point: 7.7761

>T266305 WP_000854914.1 NZ_CP114130:c2843614-2843240 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13718.51 Da        Isoelectric Point: 6.6249

>AT266305 WP_001280954.1 NZ_CP114130:c2844035-2843661 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLNAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LXR5

Antitoxin

Source ID Structure
AlphaFold DB A0A0B0VS41

References