Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3904098..3904735 | Replicon | chromosome |
| Accession | NZ_CP114038 | ||
| Organism | Bacillus velezensis strain B8 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | OZA25_RS19370 | Protein ID | WP_003156187.1 |
| Coordinates | 3904098..3904448 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | OZA25_RS19375 | Protein ID | WP_003156188.1 |
| Coordinates | 3904454..3904735 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZA25_RS19330 (OZA25_19330) | 3899138..3899740 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
| OZA25_RS19335 (OZA25_19335) | 3899740..3900528 | - | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
| OZA25_RS19340 (OZA25_19340) | 3900494..3900976 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| OZA25_RS19345 (OZA25_19345) | 3900973..3901302 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| OZA25_RS19350 (OZA25_19350) | 3901366..3902373 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
| OZA25_RS19355 (OZA25_19355) | 3902385..3902786 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| OZA25_RS19360 (OZA25_19360) | 3902789..3903154 | - | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| OZA25_RS19365 (OZA25_19365) | 3903159..3903980 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| OZA25_RS19370 (OZA25_19370) | 3904098..3904448 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OZA25_RS19375 (OZA25_19375) | 3904454..3904735 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| OZA25_RS19380 (OZA25_19380) | 3904855..3906024 | - | 1170 | WP_032873001.1 | alanine racemase | - |
| OZA25_RS19385 (OZA25_19385) | 3906141..3907148 | - | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
| OZA25_RS19390 (OZA25_19390) | 3907313..3907678 | - | 366 | WP_007609580.1 | holo-ACP synthase | - |
| OZA25_RS19395 (OZA25_19395) | 3907771..3908370 | + | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T266223 WP_003156187.1 NZ_CP114038:c3904448-3904098 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|