Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4860073..4860589 | Replicon | chromosome |
Accession | NZ_CP114035 | ||
Organism | Pseudomonas putida strain GMI12077 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A8I0ZDP4 |
Locus tag | OZ911_RS22270 | Protein ID | WP_023047836.1 |
Coordinates | 4860073..4860360 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1L7NIA2 |
Locus tag | OZ911_RS22275 | Protein ID | WP_023047837.1 |
Coordinates | 4860350..4860589 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZ911_RS22250 (OZ911_22250) | 4856360..4856494 | + | 135 | WP_023048542.1 | hypothetical protein | - |
OZ911_RS22255 (OZ911_22255) | 4857000..4858250 | + | 1251 | WP_016488688.1 | ribonucleotide-diphosphate reductase subunit beta | - |
OZ911_RS22260 (OZ911_22260) | 4858337..4858810 | - | 474 | WP_134792775.1 | hypothetical protein | - |
OZ911_RS22265 (OZ911_22265) | 4859235..4859771 | + | 537 | WP_023047835.1 | Bro-N domain-containing protein | - |
OZ911_RS22270 (OZ911_22270) | 4860073..4860360 | - | 288 | WP_023047836.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OZ911_RS22275 (OZ911_22275) | 4860350..4860589 | - | 240 | WP_023047837.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OZ911_RS22280 (OZ911_22280) | 4861309..4862547 | + | 1239 | WP_004577198.1 | OprD family porin | - |
OZ911_RS22285 (OZ911_22285) | 4862786..4863592 | + | 807 | WP_023047838.1 | NAD(P)-dependent oxidoreductase | - |
OZ911_RS22290 (OZ911_22290) | 4863618..4864499 | + | 882 | WP_016488690.1 | SMP-30/gluconolactonase/LRE family protein | - |
OZ911_RS22295 (OZ911_22295) | 4864564..4865535 | + | 972 | WP_016488691.1 | TRAP transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11242.07 Da Isoelectric Point: 10.1560
>T266220 WP_023047836.1 NZ_CP114035:c4860360-4860073 [Pseudomonas putida]
MTYSLDFDARALKEWKKLGDTVRQQFKKKLAEVLLNPRIEANRLHSLPDCYKIKLRSSGFRLVYQVIDQEVVVFVVAVDR
RERDQAYKKAAERLE
MTYSLDFDARALKEWKKLGDTVRQQFKKKLAEVLLNPRIEANRLHSLPDCYKIKLRSSGFRLVYQVIDQEVVVFVVAVDR
RERDQAYKKAAERLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|