Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 5185209..5185714 Replicon chromosome
Accession NZ_CP113974
Organism Pseudomonas aeruginosa strain M6A146

Toxin (Protein)


Gene name parE Uniprot ID A0A7M2ZNP4
Locus tag OZ175_RS24235 Protein ID WP_009875660.1
Coordinates 5185209..5185490 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A0H2ZJU8
Locus tag OZ175_RS24240 Protein ID WP_003137009.1
Coordinates 5185487..5185714 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OZ175_RS24210 (OZ175_24210) 5180460..5181809 + 1350 WP_003142411.1 C4-dicarboxylate transporter DctA -
OZ175_RS24215 (OZ175_24215) 5181858..5182544 + 687 WP_268858346.1 FadR/GntR family transcriptional regulator -
OZ175_RS24220 (OZ175_24220) 5182645..5183379 + 735 WP_003117208.1 GntR family transcriptional regulator -
OZ175_RS24225 (OZ175_24225) 5183559..5183969 + 411 WP_003101225.1 aegerolysin family protein -
OZ175_RS24230 (OZ175_24230) 5184001..5184909 - 909 WP_003083769.1 LysR family transcriptional regulator -
OZ175_RS24235 (OZ175_24235) 5185209..5185490 - 282 WP_009875660.1 type II toxin-antitoxin system toxin ParE Toxin
OZ175_RS24240 (OZ175_24240) 5185487..5185714 - 228 WP_003137009.1 CopG family ribbon-helix-helix protein Antitoxin
OZ175_RS24245 (OZ175_24245) 5185890..5186510 - 621 WP_023086863.1 hypothetical protein -
OZ175_RS24250 (OZ175_24250) 5186611..5187111 + 501 WP_003101228.1 LEA type 2 family protein -
OZ175_RS24255 (OZ175_24255) 5187184..5187525 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
OZ175_RS24260 (OZ175_24260) 5187607..5189034 - 1428 WP_003083784.1 GABA permease -
OZ175_RS24265 (OZ175_24265) 5189203..5190696 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10461.25 Da        Isoelectric Point: 10.4670

>T266206 WP_009875660.1 NZ_CP113974:c5185490-5185209 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLKRWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8526.56 Da        Isoelectric Point: 5.5740

>AT266206 WP_003137009.1 NZ_CP113974:c5185714-5185487 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHAEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7M2ZNP4

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2ZJU8

References