Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 179239..179874 | Replicon | chromosome |
Accession | NZ_CP113827 | ||
Organism | Pandoraea sp. XJJ-1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OYT13_RS00705 | Protein ID | WP_017233795.1 |
Coordinates | 179455..179874 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OYT13_RS00700 | Protein ID | WP_130024507.1 |
Coordinates | 179239..179439 (+) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OYT13_RS00685 (OYT13_00685) | 174653..175501 | + | 849 | WP_261939416.1 | patatin-like phospholipase family protein | - |
OYT13_RS00690 (OYT13_00690) | 175525..176535 | - | 1011 | WP_130024506.1 | D-2-hydroxyacid dehydrogenase family protein | - |
OYT13_RS00695 (OYT13_00695) | 177098..178987 | + | 1890 | WP_261939415.1 | phosphoenolpyruvate carboxykinase (GTP) | - |
OYT13_RS00700 (OYT13_00700) | 179239..179439 | + | 201 | WP_130024507.1 | DNA-binding protein | Antitoxin |
OYT13_RS00705 (OYT13_00705) | 179455..179874 | + | 420 | WP_017233795.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OYT13_RS00710 (OYT13_00710) | 179949..180581 | - | 633 | WP_150562011.1 | response regulator transcription factor | - |
OYT13_RS00715 (OYT13_00715) | 180578..181963 | - | 1386 | WP_017233793.1 | cache domain-containing protein | - |
OYT13_RS00720 (OYT13_00720) | 182329..184395 | + | 2067 | WP_017233792.1 | carbon starvation CstA family protein | - |
OYT13_RS00725 (OYT13_00725) | 184412..184609 | + | 198 | WP_017233791.1 | YbdD/YjiX family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 16029.49 Da Isoelectric Point: 9.6766
>T266073 WP_017233795.1 NZ_CP113827:179455-179874 [Pandoraea sp. XJJ-1]
MYLLDTNVISECRKCGGGDEGVQRFIRRTDRDQSPRFLSVITLGELQRGVKVLRHRNDARQAVLIEAWLEKLKRDYAREI
LPVDQTICNVWARLRVPHSEHPIDKLIAATALVHRLVVVTRNVRDFSSTGVEVYNPFVH
MYLLDTNVISECRKCGGGDEGVQRFIRRTDRDQSPRFLSVITLGELQRGVKVLRHRNDARQAVLIEAWLEKLKRDYAREI
LPVDQTICNVWARLRVPHSEHPIDKLIAATALVHRLVVVTRNVRDFSSTGVEVYNPFVH
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|