Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ygfYX/Cpta(toxin) |
Location | 4007504..4008173 | Replicon | chromosome |
Accession | NZ_CP113808 | ||
Organism | Shewanella sp. DAU305 |
Toxin (Protein)
Gene name | ygfX | Uniprot ID | - |
Locus tag | OX890_RS17005 | Protein ID | WP_268649608.1 |
Coordinates | 4007504..4007944 (-) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | ygfY | Uniprot ID | - |
Locus tag | OX890_RS17010 | Protein ID | WP_126492496.1 |
Coordinates | 4007925..4008173 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OX890_RS16980 (OX890_16980) | 4002974..4003447 | - | 474 | WP_006080776.1 | SoxR reducing system RseC family protein | - |
OX890_RS16985 (OX890_16985) | 4003458..4004390 | - | 933 | WP_006080775.1 | MucB/RseB C-terminal domain-containing protein | - |
OX890_RS16990 (OX890_16990) | 4004403..4005029 | - | 627 | WP_006080774.1 | RseA family anti-sigma factor | - |
OX890_RS16995 (OX890_16995) | 4005071..4005649 | - | 579 | WP_006080773.1 | RNA polymerase sigma factor RpoE | - |
OX890_RS17000 (OX890_17000) | 4005839..4007452 | + | 1614 | WP_168823426.1 | L-aspartate oxidase | - |
OX890_RS17005 (OX890_17005) | 4007504..4007944 | - | 441 | WP_268649608.1 | protein YgfX | Toxin |
OX890_RS17010 (OX890_17010) | 4007925..4008173 | - | 249 | WP_126492496.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
OX890_RS17015 (OX890_17015) | 4008259..4009167 | - | 909 | WP_063884532.1 | transcriptional activator NhaR | - |
OX890_RS17020 (OX890_17020) | 4009240..4009626 | - | 387 | WP_126492497.1 | hypothetical protein | - |
OX890_RS17025 (OX890_17025) | 4009629..4010798 | - | 1170 | WP_006080767.1 | Na+/H+ antiporter NhaA | - |
OX890_RS17030 (OX890_17030) | 4010916..4011710 | - | 795 | WP_006080766.1 | thymidylate synthase | - |
OX890_RS17035 (OX890_17035) | 4011707..4012516 | - | 810 | WP_268649609.1 | prolipoprotein diacylglyceryl transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 17314.40 Da Isoelectric Point: 8.0619
>T266072 WP_268649608.1 NZ_CP113808:c4007944-4007504 [Shewanella sp. DAU305]
VEDRHHSFSVKASFDQRLSLVVFICVCSSSFLLWPQSDNLTLSLIKYLFILLVCIFLLSQLWRLQHWRLDFVLSDKGEGR
LSTGEHFQVLKRTWVTPFVCLMYIEVDTQLRLLMVWADMLDDTDYRHLCRLLLRAKIKQTKPHTEV
VEDRHHSFSVKASFDQRLSLVVFICVCSSSFLLWPQSDNLTLSLIKYLFILLVCIFLLSQLWRLQHWRLDFVLSDKGEGR
LSTGEHFQVLKRTWVTPFVCLMYIEVDTQLRLLMVWADMLDDTDYRHLCRLLLRAKIKQTKPHTEV
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|