Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Fic-DUF1778
Location 353956..354527 Replicon plasmid pA
Accession NZ_CP113799
Organism Rhodococcus pyridinivorans strain P23

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag OQN32_RS25870 Protein ID WP_139000138.1
Coordinates 354150..354527 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag OQN32_RS25865 Protein ID WP_139000137.1
Coordinates 353956..354153 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQN32_RS25835 (OQN32_25835) 349713..350180 + 468 Protein_291 transposase -
OQN32_RS25840 (OQN32_25840) 350474..351453 - 980 Protein_292 IS481 family transposase -
OQN32_RS25845 (OQN32_25845) 351811..352068 - 258 WP_139000135.1 Txe/YoeB family addiction module toxin -
OQN32_RS25850 (OQN32_25850) 352070..352327 - 258 WP_139000136.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
OQN32_RS25855 (OQN32_25855) 352380..352535 + 156 Protein_295 plasmid pRiA4b ORF-3 family protein -
OQN32_RS25860 (OQN32_25860) 352826..353777 + 952 Protein_296 transposase -
OQN32_RS25865 (OQN32_25865) 353956..354153 + 198 WP_139000137.1 DUF1778 domain-containing protein Antitoxin
OQN32_RS25870 (OQN32_25870) 354150..354527 + 378 WP_139000138.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OQN32_RS25875 (OQN32_25875) 355136..355279 - 144 WP_268655831.1 hypothetical protein -
OQN32_RS25880 (OQN32_25880) 355437..355790 + 354 WP_268655832.1 hypothetical protein -
OQN32_RS25885 (OQN32_25885) 355880..356017 + 138 WP_240795125.1 hypothetical protein -
OQN32_RS25890 (OQN32_25890) 356078..356950 + 873 WP_139000139.1 Abi family protein -
OQN32_RS25895 (OQN32_25895) 357009..358142 - 1134 WP_268655833.1 IS630 family transposase -
OQN32_RS25900 (OQN32_25900) 358337..358543 - 207 WP_268655834.1 hypothetical protein -
OQN32_RS25905 (OQN32_25905) 358527..359030 - 504 WP_139000140.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..580882 580882
- inside IScluster/Tn - - 350474..353777 3303


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(5-83)

Antitoxin

Vibrio phage ICP1, Orf50

(4-40)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13306.09 Da        Isoelectric Point: 6.2143

>T266067 WP_139000138.1 NZ_CP113799:354150-354527 [Rhodococcus pyridinivorans]
VTFYLDRDDLLTIAARVNGGSPAVREMGLLDAAIARPQSTVFGVDAYPTLFEKAAALLHSIARNHALVDGNKRTAWAATW
LFLGYNGIRLQRGFDVDAAEALMNDTATGAHDVASIAASLAKFTA

Download         Length: 378 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7210.02 Da        Isoelectric Point: 4.5067

>AT266067 WP_139000137.1 NZ_CP113799:353956-354153 [Rhodococcus pyridinivorans]
MPGLNIQFTDDEQALIRDAADREGISLKAFVHNASLDAASSRKHLRDELLADIFDKSAELNDRLA

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References