Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 2490492..2491033 | Replicon | chromosome |
Accession | NZ_CP113797 | ||
Organism | Leptolyngbya sp. PKUAC-SCTA174 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OXH18_RS10755 | Protein ID | WP_268612782.1 |
Coordinates | 2490492..2490812 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OXH18_RS10760 | Protein ID | WP_268612783.1 |
Coordinates | 2490809..2491033 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXH18_RS10750 (OXH18_10750) | 2486468..2490352 | + | 3885 | WP_268612781.1 | hypothetical protein | - |
OXH18_RS10755 (OXH18_10755) | 2490492..2490812 | - | 321 | WP_268612782.1 | DUF5615 family PIN-like protein | Toxin |
OXH18_RS10760 (OXH18_10760) | 2490809..2491033 | - | 225 | WP_268612783.1 | DUF433 domain-containing protein | Antitoxin |
OXH18_RS10765 (OXH18_10765) | 2491061..2491279 | - | 219 | WP_268612784.1 | hypothetical protein | - |
OXH18_RS10770 (OXH18_10770) | 2491284..2491412 | - | 129 | WP_268612785.1 | hypothetical protein | - |
OXH18_RS10775 (OXH18_10775) | 2491762..2492916 | + | 1155 | WP_268612786.1 | XdhC/CoxI family protein | - |
OXH18_RS10780 (OXH18_10780) | 2492999..2493649 | + | 651 | WP_268612787.1 | nucleotidyltransferase family protein | - |
OXH18_RS10785 (OXH18_10785) | 2493616..2494662 | - | 1047 | WP_268612788.1 | DUF3616 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 11712.45 Da Isoelectric Point: 4.3184
>T266063 WP_268612782.1 NZ_CP113797:c2490812-2490492 [Leptolyngbya sp. PKUAC-SCTA174]
MTTIWIDAHLSPAIATWITDTFGITALALRDLSLRDAEDPEIFEAAKAQGIIFMTKDSDFVDLVERLGSPPQIIWLTCGN
TSNARLREILSAVLPETLKLLRSGEN
MTTIWIDAHLSPAIATWITDTFGITALALRDLSLRDAEDPEIFEAAKAQGIIFMTKDSDFVDLVERLGSPPQIIWLTCGN
TSNARLREILSAVLPETLKLLRSGEN
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|