Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2236254..2236452 | Replicon | chromosome |
Accession | NC_017337 | ||
Organism | Staphylococcus aureus subsp. aureus ED133 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAOV_RS11510 | Protein ID | WP_001802298.1 |
Coordinates | 2236348..2236452 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2236254..2236292 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAOV_RS11490 | 2232363..2233028 | - | 666 | WP_001024100.1 | SDR family oxidoreductase | - |
SAOV_RS11495 | 2233180..2233500 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAOV_RS11500 | 2233502..2234482 | + | 981 | WP_000019740.1 | CDF family zinc efflux transporter CzrB | - |
SAOV_RS11505 | 2234748..2235839 | + | 1092 | WP_000495692.1 | hypothetical protein | - |
- | 2236254..2236292 | + | 39 | - | - | Antitoxin |
SAOV_RS11510 | 2236348..2236452 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAOV_RS15365 | 2236613..2237096 | - | 484 | Protein_2175 | recombinase family protein | - |
SAOV_RS15105 | 2237139..2238259 | - | 1121 | Protein_2176 | SAP domain-containing protein | - |
SAOV_RS11530 | 2239300..2240157 | - | 858 | WP_000370943.1 | Cof-type HAD-IIB family hydrolase | - |
SAOV_RS11535 | 2240225..2241007 | - | 783 | WP_000909235.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T26599 WP_001802298.1 NC_017337:c2236452-2236348 [Staphylococcus aureus subsp. aureus ED133]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T26599 NC_017337:c2236452-2236348 [Staphylococcus aureus subsp. aureus ED133]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT26599 NC_017337:2236254-2236292 [Staphylococcus aureus subsp. aureus ED133]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|