Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4031557..4032073 | Replicon | chromosome |
| Accession | NZ_CP113537 | ||
| Organism | Salmonella enterica strain YZY | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3V5VNJ7 |
| Locus tag | OXV04_RS19265 | Protein ID | WP_000220577.1 |
| Coordinates | 4031557..4031841 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | OXV04_RS19270 | Protein ID | WP_000212724.1 |
| Coordinates | 4031831..4032073 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV04_RS19250 (4026769) | 4026769..4028421 | + | 1653 | WP_126524329.1 | alpha,alpha-phosphotrehalase | - |
| OXV04_RS19255 (4028830) | 4028830..4030968 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OXV04_RS19260 (4031089) | 4031089..4031553 | + | 465 | WP_031605772.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OXV04_RS19265 (4031557) | 4031557..4031841 | - | 285 | WP_000220577.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OXV04_RS19270 (4031831) | 4031831..4032073 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OXV04_RS19275 (4032151) | 4032151..4034064 | - | 1914 | WP_140902122.1 | BglG family transcription antiterminator | - |
| OXV04_RS19280 (4034081) | 4034081..4034821 | - | 741 | WP_126524331.1 | KDGP aldolase family protein | - |
| OXV04_RS19285 (4034818) | 4034818..4035936 | - | 1119 | WP_126524332.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| OXV04_RS19290 (4035920) | 4035920..4037053 | - | 1134 | WP_126524333.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.71 Da Isoelectric Point: 9.8739
>T265947 WP_000220577.1 NZ_CP113537:c4031841-4031557 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V5VNJ7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |