Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1851312..1851902 | Replicon | chromosome |
Accession | NZ_CP113537 | ||
Organism | Salmonella enterica strain YZY |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A3S5G4X7 |
Locus tag | OXV04_RS08685 | Protein ID | WP_039591092.1 |
Coordinates | 1851570..1851902 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A3V3TWU4 |
Locus tag | OXV04_RS08680 | Protein ID | WP_039520052.1 |
Coordinates | 1851312..1851569 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV04_RS08665 (1848640) | 1848640..1849902 | - | 1263 | WP_206612204.1 | hypothetical protein | - |
OXV04_RS08670 (1850288) | 1850288..1850761 | + | 474 | WP_126523999.1 | hypothetical protein | - |
OXV04_RS08675 (1850758) | 1850758..1850964 | + | 207 | WP_268651589.1 | helix-turn-helix transcriptional regulator | - |
OXV04_RS08680 (1851312) | 1851312..1851569 | + | 258 | WP_039520052.1 | antitoxin | Antitoxin |
OXV04_RS08685 (1851570) | 1851570..1851902 | + | 333 | WP_039591092.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OXV04_RS08690 (1852735) | 1852735..1853619 | + | 885 | WP_126524002.1 | integrase domain-containing protein | - |
OXV04_RS08695 (1854649) | 1854649..1855911 | - | 1263 | WP_126524003.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1841548..1851902 | 10354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11765.62 Da Isoelectric Point: 10.5834
>T265939 WP_039591092.1 NZ_CP113537:1851570-1851902 [Salmonella enterica]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARAAGFTVSLEGAGTKTTGVIRCDQPRTI
DMGARNGKRLERIPDAVVNEVLARLEAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S5G4X7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V3TWU4 |