Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 229315..229537 Replicon chromosome
Accession NZ_CP113503
Organism Escherichia coli strain 16843

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag OWO50_RS01105 Protein ID WP_001295224.1
Coordinates 229430..229537 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 229315..229381 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OWO50_RS01085 224756..225658 + 903 WP_000084677.1 dipeptide ABC transporter permease DppC -
OWO50_RS01090 225669..226652 + 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -
OWO50_RS01095 226649..227653 + 1005 WP_000103577.1 dipeptide ABC transporter ATP-binding subunit DppF -
OWO50_RS01100 227683..228954 - 1272 WP_001298005.1 aromatic amino acid transport family protein -
- 229315..229381 - 67 - - Antitoxin
OWO50_RS01105 229430..229537 + 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
OWO50_RS01110 229624..231255 - 1632 WP_219102302.1 cellulose biosynthesis protein BcsG -
OWO50_RS01115 231245..231322 - 78 Protein_220 cellulose biosynthesis protein BcsF -
OWO50_RS01120 231319..232890 - 1572 WP_219102300.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
OWO50_RS01125 233163..233351 + 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
OWO50_RS01130 233363..234115 + 753 WP_000279536.1 cellulose biosynthesis protein BcsQ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T265813 WP_001295224.1 NZ_CP113503:229430-229537 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT265813 NZ_CP113503:c229381-229315 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References