Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 47744..47998 Replicon plasmid unnamed1
Accession NZ_CP113487
Organism Escherichia coli strain GTEN_23

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag FG550_RS25300 Protein ID WP_001312851.1
Coordinates 47744..47893 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 47937..47998 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FG550_RS25260 (43538) 43538..43795 + 258 WP_021579169.1 hypothetical protein -
FG550_RS25265 (43945) 43945..44043 - 99 WP_137491101.1 transposase -
FG550_RS25270 (44236) 44236..44544 + 309 Protein_54 transposase -
FG550_RS25275 (45572) 45572..46429 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
FG550_RS25280 (46422) 46422..46904 - 483 WP_001273588.1 hypothetical protein -
FG550_RS25285 (46897) 46897..46944 - 48 WP_229471593.1 hypothetical protein -
FG550_RS25290 (46935) 46935..47186 + 252 WP_223195197.1 replication protein RepA -
FG550_RS25295 (47203) 47203..47460 - 258 WP_000083845.1 replication regulatory protein RepA -
FG550_RS25300 (47744) 47744..47893 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (47937) 47937..47998 + 62 NuclAT_1 - Antitoxin
- (47937) 47937..47998 + 62 NuclAT_1 - Antitoxin
- (47937) 47937..47998 + 62 NuclAT_1 - Antitoxin
- (47937) 47937..47998 + 62 NuclAT_1 - Antitoxin
FG550_RS25305 (48254) 48254..48328 - 75 Protein_61 endonuclease -
FG550_RS25310 (48574) 48574..48786 - 213 WP_001299730.1 ANR family transcriptional regulator -
FG550_RS25315 (48922) 48922..49482 - 561 WP_000139315.1 fertility inhibition protein FinO -
FG550_RS25320 (49585) 49585..50445 - 861 WP_000704513.1 alpha/beta hydrolase -
FG550_RS25325 (50504) 50504..50998 - 495 WP_001563729.1 type-F conjugative transfer system pilin acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B iutA / iucD / iucC / iucB / iucA 1..123389 123389
- flank IS/Tn - - 44278..44544 266


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T265768 WP_001312851.1 NZ_CP113487:c47893-47744 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 62 bp

>AT265768 NZ_CP113487:47937-47998 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References