Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2985498..2986100 | Replicon | chromosome |
| Accession | NZ_CP113486 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | FG550_RS14380 | Protein ID | WP_000897305.1 |
| Coordinates | 2985498..2985809 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FG550_RS14385 | Protein ID | WP_000356395.1 |
| Coordinates | 2985810..2986100 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS14355 (2980540) | 2980540..2980977 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| FG550_RS14360 (2981022) | 2981022..2981963 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| FG550_RS14365 (2982379) | 2982379..2983266 | + | 888 | Protein_2806 | hypothetical protein | - |
| FG550_RS14370 (2983279) | 2983279..2984193 | + | 915 | WP_109553727.1 | transposase | - |
| FG550_RS14375 (2984361) | 2984361..2985269 | - | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| FG550_RS14380 (2985498) | 2985498..2985809 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| FG550_RS14385 (2985810) | 2985810..2986100 | + | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| FG550_RS14390 (2986185) | 2986185..2986406 | + | 222 | WP_001550354.1 | hypothetical protein | - |
| FG550_RS14395 (2986458) | 2986458..2986736 | + | 279 | WP_001315112.1 | hypothetical protein | - |
| FG550_RS14400 (2987155) | 2987155..2987373 | + | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| FG550_RS14405 (2987592) | 2987592..2987834 | + | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| FG550_RS14410 (2988016) | 2988016..2988945 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| FG550_RS14415 (2988942) | 2988942..2989577 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| FG550_RS14420 (2989574) | 2989574..2990476 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T265754 WP_000897305.1 NZ_CP113486:2985498-2985809 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|