Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1946177..1947012 Replicon chromosome
Accession NZ_CP113486
Organism Escherichia coli strain GTEN_23

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag FG550_RS09445 Protein ID WP_001564063.1
Coordinates 1946635..1947012 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0K5N986
Locus tag FG550_RS09440 Protein ID WP_021553056.1
Coordinates 1946177..1946545 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FG550_RS09405 (1941836) 1941836..1942516 + 681 WP_001278649.1 WYL domain-containing protein -
FG550_RS09410 (1942667) 1942667..1943344 + 678 WP_001564058.1 hypothetical protein -
FG550_RS09415 (1943350) 1943350..1943583 + 234 WP_001278293.1 DUF905 family protein -
FG550_RS09420 (1943673) 1943673..1944491 + 819 WP_001564059.1 DUF932 domain-containing protein -
FG550_RS09425 (1944757) 1944757..1945236 + 480 WP_001564060.1 antirestriction protein -
FG550_RS09430 (1945252) 1945252..1945728 + 477 WP_021553055.1 RadC family protein -
FG550_RS09435 (1945793) 1945793..1946014 + 222 WP_000692345.1 DUF987 domain-containing protein -
FG550_RS09440 (1946177) 1946177..1946545 + 369 WP_021553056.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
FG550_RS09445 (1946635) 1946635..1947012 + 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
FG550_RS09450 (1947009) 1947009..1947158 + 150 Protein_1853 DUF5983 family protein -
FG550_RS09455 (1947237) 1947237..1947431 + 195 WP_024181941.1 DUF957 domain-containing protein -
FG550_RS09460 (1947516) 1947516..1948358 + 843 Protein_1855 DUF4942 domain-containing protein -
FG550_RS09465 (1948701) 1948701..1948871 + 171 Protein_1856 IS110 family transposase -
FG550_RS09470 (1949681) 1949681..1950664 + 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
FG550_RS09475 (1950736) 1950736..1951884 + 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX / kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT / kpsM / gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspE / gspD / gspC 1853982..2026484 172502
- flank IS/Tn - - 1948716..1948871 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T265751 WP_001564063.1 NZ_CP113486:1946635-1947012 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13615.39 Da        Isoelectric Point: 7.0264

>AT265751 WP_021553056.1 NZ_CP113486:1946177-1946545 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0K5N986

References