Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1871480..1872315 Replicon chromosome
Accession NZ_CP113486
Organism Escherichia coli strain GTEN_23

Toxin (Protein)


Gene name yeeV Uniprot ID S1PMM7
Locus tag FG550_RS09025 Protein ID WP_000854720.1
Coordinates 1871938..1872315 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P8X0
Locus tag FG550_RS09020 Protein ID WP_001539669.1
Coordinates 1871480..1871848 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FG550_RS08980 (1866488) 1866488..1868026 - 1539 WP_021545098.1 IS66-like element ISEc22 family transposase -
FG550_RS08985 (1868075) 1868075..1868422 - 348 WP_000612617.1 IS66 family insertion sequence element accessory protein TnpB -
FG550_RS08990 (1868419) 1868419..1868823 - 405 WP_001539664.1 transposase -
FG550_RS08995 (1868909) 1868909..1869142 + 234 WP_001119719.1 DUF905 family protein -
FG550_RS09000 (1869242) 1869242..1870060 + 819 WP_001234642.1 DUF932 domain-containing protein -
FG550_RS09005 (1870115) 1870115..1870600 + 486 WP_000849596.1 antirestriction protein -
FG550_RS09010 (1870616) 1870616..1871092 + 477 WP_001186788.1 RadC family protein -
FG550_RS09015 (1871179) 1871179..1871400 + 222 WP_000692349.1 DUF987 domain-containing protein -
FG550_RS09020 (1871480) 1871480..1871848 + 369 WP_001539669.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
FG550_RS09025 (1871938) 1871938..1872315 + 378 WP_000854720.1 TA system toxin CbtA family protein Toxin
FG550_RS09030 (1872312) 1872312..1872800 + 489 WP_021535504.1 DUF5983 family protein -
FG550_RS09035 (1872812) 1872812..1873009 + 198 WP_000839238.1 DUF957 domain-containing protein -
FG550_RS09040 (1873102) 1873102..1873968 + 867 WP_001290180.1 DUF4942 domain-containing protein -
FG550_RS09045 (1874040) 1874040..1874303 + 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
FG550_RS09050 (1874300) 1874300..1874626 + 327 WP_000779482.1 type II toxin-antitoxin system RelE/ParE family toxin -
FG550_RS09055 (1875090) 1875090..1876355 + 1266 WP_001218869.1 integrase arm-type DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX / kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT / kpsM / gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspE / gspD / gspC 1853982..2026484 172502


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14089.02 Da        Isoelectric Point: 7.9087

>T265750 WP_000854720.1 NZ_CP113486:1871938-1872315 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGTSSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13614.39 Da        Isoelectric Point: 5.9550

>AT265750 WP_001539669.1 NZ_CP113486:1871480-1871848 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSN
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FW05

Antitoxin

Source ID Structure
AlphaFold DB A0A829FYK7

References