Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 1033621..1034216 | Replicon | chromosome |
| Accession | NZ_CP113246 | ||
| Organism | Pseudomonas aeruginosa strain SMC4386 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | OUY23_RS04715 | Protein ID | WP_003117425.1 |
| Coordinates | 1033621..1033899 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OUY23_RS04720 | Protein ID | WP_003113527.1 |
| Coordinates | 1033911..1034216 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUY23_RS04695 (OUY23_04695) | 1029047..1030285 | + | 1239 | WP_003113524.1 | dipeptidase | - |
| OUY23_RS04700 (OUY23_04700) | 1030347..1030994 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| OUY23_RS04705 (OUY23_04705) | 1031064..1033292 | - | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| OUY23_RS04710 (OUY23_04710) | 1033440..1033568 | + | 129 | Protein_923 | integrase | - |
| OUY23_RS04715 (OUY23_04715) | 1033621..1033899 | + | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OUY23_RS04720 (OUY23_04720) | 1033911..1034216 | + | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| OUY23_RS04725 (OUY23_04725) | 1034553..1034945 | + | 393 | WP_052155873.1 | hypothetical protein | - |
| OUY23_RS04730 (OUY23_04730) | 1035336..1036574 | + | 1239 | WP_141265240.1 | hypothetical protein | - |
| OUY23_RS04735 (OUY23_04735) | 1036589..1037599 | + | 1011 | WP_141265242.1 | hypothetical protein | - |
| OUY23_RS04740 (OUY23_04740) | 1037544..1038158 | + | 615 | WP_141265244.1 | hypothetical protein | - |
| OUY23_RS04745 (OUY23_04745) | 1038178..1038513 | - | 336 | WP_058876602.1 | hypothetical protein | - |
| OUY23_RS04750 (OUY23_04750) | 1038569..1038835 | - | 267 | WP_023088595.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T265654 WP_003117425.1 NZ_CP113246:1033621-1033899 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|