Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4755514..4756030 | Replicon | chromosome |
| Accession | NZ_CP113178 | ||
| Organism | Klebsiella pneumoniae strain SYCC1 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | OT490_RS22925 | Protein ID | WP_004178374.1 |
| Coordinates | 4755514..4755798 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | OT490_RS22930 | Protein ID | WP_002886901.1 |
| Coordinates | 4755788..4756030 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OT490_RS22900 (4750998) | 4750998..4751261 | - | 264 | WP_020324507.1 | PTS system, lactose/cellobiose-specific IIB subunit | - |
| OT490_RS22905 (4751391) | 4751391..4751564 | + | 174 | WP_032408826.1 | hypothetical protein | - |
| OT490_RS22910 (4751567) | 4751567..4752310 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| OT490_RS22915 (4752667) | 4752667..4754805 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OT490_RS22920 (4755046) | 4755046..4755510 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OT490_RS22925 (4755514) | 4755514..4755798 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OT490_RS22930 (4755788) | 4755788..4756030 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OT490_RS22935 (4756108) | 4756108..4758018 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
| OT490_RS22940 (4758041) | 4758041..4759195 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
| OT490_RS22945 (4759262) | 4759262..4760002 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T265511 WP_004178374.1 NZ_CP113178:c4755798-4755514 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |