Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 1902476..1903005 Replicon chromosome
Accession NZ_CP113009
Organism Staphylococcus aureus strain Orianna

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag OS092_RS09905 Protein ID WP_000621175.1
Coordinates 1902476..1902838 (-) Length 121 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID T1YCG8
Locus tag OS092_RS09910 Protein ID WP_000948331.1
Coordinates 1902835..1903005 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OS092_RS09880 1898041..1899253 + 1213 Protein_1906 IS256-like element IS256 family transposase -
OS092_RS09885 1899455..1900225 - 771 WP_001041103.1 RNA polymerase sigma factor SigB -
OS092_RS09890 1900200..1900679 - 480 WP_001190829.1 anti-sigma B factor RsbW -
OS092_RS09895 1900681..1901007 - 327 WP_001052491.1 anti-sigma factor antagonist -
OS092_RS09900 1901126..1902127 - 1002 WP_000390829.1 PP2C family protein-serine/threonine phosphatase -
OS092_RS09905 1902476..1902838 - 363 WP_000621175.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OS092_RS09910 1902835..1903005 - 171 WP_000948331.1 type II toxin-antitoxin system antitoxin MazE Antitoxin
OS092_RS09915 1903090..1904238 - 1149 WP_001281145.1 alanine racemase -
OS092_RS09920 1904304..1904663 - 360 WP_000581200.1 holo-ACP synthase -
OS092_RS09925 1904667..1905158 - 492 WP_001205910.1 PH domain-containing protein -
OS092_RS09930 1905145..1906728 - 1584 WP_001294626.1 PH domain-containing protein -
OS092_RS09935 1906721..1907200 - 480 WP_001287088.1 hypothetical protein -
OS092_RS09940 1907408..1907968 - 561 WP_001092411.1 K(+)-transporting ATPase subunit C -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1898147..1899253 1106


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(3-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 121 a.a.        Molecular weight: 13441.69 Da        Isoelectric Point: 10.1654

>T265139 WP_000621175.1 NZ_CP113009:c1902838-1902476 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN

Download         Length: 363 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6251.78 Da        Isoelectric Point: 3.8305

>AT265139 WP_000948331.1 NZ_CP113009:c1903005-1902835 [Staphylococcus aureus]
MLSFSQNRSHSLEQSLKEGYSQMADLNLSLANEAFPIECEACDCNETYLSSNSTNE

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VRZ1

References