Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2350459..2351154 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O53501 |
Locus tag | ORO19_RS10965 | Protein ID | WP_003410811.1 |
Coordinates | 2350459..2350893 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TMN0 |
Locus tag | ORO19_RS10970 | Protein ID | WP_003410814.1 |
Coordinates | 2350900..2351154 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS10955 (ORO19_10955) | 2346613..2349654 | + | 3042 | WP_010950658.1 | DEAD/DEAH box helicase | - |
ORO19_RS10960 (ORO19_10960) | 2349647..2350480 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
ORO19_RS10965 (ORO19_10965) | 2350459..2350893 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORO19_RS10970 (ORO19_10970) | 2350900..2351154 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
ORO19_RS10975 (ORO19_10975) | 2351170..2351427 | - | 258 | WP_003410816.1 | hypothetical protein | - |
ORO19_RS10980 (ORO19_10980) | 2352374..2352670 | + | 297 | WP_003410820.1 | PE family protein | - |
ORO19_RS10985 (ORO19_10985) | 2352726..2353457 | + | 732 | WP_003900467.1 | PPE family protein | - |
ORO19_RS10990 (ORO19_10990) | 2353997..2354743 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
ORO19_RS10995 (ORO19_10995) | 2354740..2355615 | - | 876 | WP_003411023.1 | proteasome subunit beta | - |
ORO19_RS11000 (ORO19_11000) | 2355612..2355806 | - | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T265020 WP_003410811.1 NZ_CP112996:c2350893-2350459 [Mycobacterium tuberculosis variant bovis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FB09 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TMN0 |