Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2199846..2200390 Replicon chromosome
Accession NZ_CP112996
Organism Mycobacterium tuberculosis variant bovis strain 2018/0565

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag ORO19_RS10260 Protein ID WP_003409896.1
Coordinates 2199846..2200142 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag ORO19_RS10265 Protein ID WP_003409899.1
Coordinates 2200139..2200390 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORO19_RS10205 (ORO19_10205) 2194879..2195229 - 351 WP_003409871.1 hypothetical protein -
ORO19_RS10210 (ORO19_10210) 2195240..2196142 - 903 WP_003409874.1 hypothetical protein -
ORO19_RS10215 (ORO19_10215) 2196163..2196354 - 192 WP_003409876.1 hypothetical protein -
ORO19_RS10220 (ORO19_10220) 2196355..2196651 - 297 WP_003409877.1 hypothetical protein -
ORO19_RS10225 (ORO19_10225) 2196891..2197106 + 216 WP_003409878.1 antitoxin -
ORO19_RS10230 (ORO19_10230) 2197103..2197414 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
ORO19_RS10235 (ORO19_10235) 2197388..2197909 - 522 WP_010950637.1 hypothetical protein -
ORO19_RS10240 (ORO19_10240) 2197884..2198261 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
ORO19_RS10245 (ORO19_10245) 2198303..2198752 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
ORO19_RS10250 (ORO19_10250) 2198749..2199294 + 546 WP_003409891.1 SecB-like chaperone -
ORO19_RS10255 (ORO19_10255) 2199183..2199797 - 615 WP_003901296.1 hypothetical protein -
ORO19_RS10260 (ORO19_10260) 2199846..2200142 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORO19_RS10265 (ORO19_10265) 2200139..2200390 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
ORO19_RS10270 (ORO19_10270) 2200377..2200871 + 495 WP_003899099.1 hypothetical protein -
ORO19_RS10275 (ORO19_10275) 2201031..2201438 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
ORO19_RS10280 (ORO19_10280) 2201442..2201714 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
ORO19_RS10285 (ORO19_10285) 2201747..2202967 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
ORO19_RS10290 (ORO19_10290) 2203866..2204171 + 306 Protein_2033 ABC transporter permease -
ORO19_RS10295 (ORO19_10295) 2204167..2204247 + 81 Protein_2034 hypothetical protein -
ORO19_RS10300 (ORO19_10300) 2204355..2205203 + 849 WP_010950638.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T265013 WP_003409896.1 NZ_CP112996:c2200142-2199846 [Mycobacterium tuberculosis variant bovis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT265013 WP_003409899.1 NZ_CP112996:c2200390-2200139 [Mycobacterium tuberculosis variant bovis]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References