Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2190809..2191512 | Replicon | chromosome |
Accession | NZ_CP112996 | ||
Organism | Mycobacterium tuberculosis variant bovis strain 2018/0565 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TLK7 |
Locus tag | ORO19_RS10170 | Protein ID | WP_003409778.1 |
Coordinates | 2190809..2191138 (-) | Length | 110 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TLK8 |
Locus tag | ORO19_RS10175 | Protein ID | WP_003409780.1 |
Coordinates | 2191135..2191512 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORO19_RS10150 (ORO19_10150) | 2187192..2188262 | + | 1071 | WP_003899091.1 | epoxide hydrolase EphB | - |
ORO19_RS10155 (ORO19_10155) | 2188259..2188774 | + | 516 | WP_003409718.1 | flavin reductase family protein | - |
ORO19_RS10160 (ORO19_10160) | 2188771..2189832 | + | 1062 | WP_003899092.1 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
ORO19_RS10165 (ORO19_10165) | 2189829..2190599 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
ORO19_RS10170 (ORO19_10170) | 2190809..2191138 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ORO19_RS10175 (ORO19_10175) | 2191135..2191512 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
ORO19_RS10180 (ORO19_10180) | 2191509..2192099 | - | 591 | WP_003409784.1 | SEC-C metal-binding domain-containing protein | - |
ORO19_RS10185 (ORO19_10185) | 2192154..2193518 | + | 1365 | WP_003899094.1 | HNH endonuclease signature motif containing protein | - |
ORO19_RS10190 (ORO19_10190) | 2193673..2194125 | - | 453 | WP_010950636.1 | lipoprotein | - |
ORO19_RS10195 (ORO19_10195) | 2194189..2194590 | + | 402 | WP_003409869.1 | hypothetical protein | - |
ORO19_RS10200 (ORO19_10200) | 2194583..2194765 | - | 183 | WP_003409870.1 | hypothetical protein | - |
ORO19_RS10205 (ORO19_10205) | 2194879..2195229 | - | 351 | WP_003409871.1 | hypothetical protein | - |
ORO19_RS10210 (ORO19_10210) | 2195240..2196142 | - | 903 | WP_003409874.1 | hypothetical protein | - |
ORO19_RS10215 (ORO19_10215) | 2196163..2196354 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T265011 WP_003409778.1 NZ_CP112996:c2191138-2190809 [Mycobacterium tuberculosis variant bovis]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT265011 WP_003409780.1 NZ_CP112996:c2191512-2191135 [Mycobacterium tuberculosis variant bovis]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|