Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 3768197..3768761 | Replicon | chromosome |
| Accession | NZ_CP112867 | ||
| Organism | Pseudomonas quebecensis isolate S1Bt7 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OSC48_RS17200 | Protein ID | WP_266246111.1 |
| Coordinates | 3768474..3768761 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OSC48_RS17195 | Protein ID | WP_181081261.1 |
| Coordinates | 3768197..3768484 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSC48_RS17160 (OSC48_17160) | 3763309..3764088 | - | 780 | WP_181081266.1 | amino acid ABC transporter ATP-binding protein | - |
| OSC48_RS17165 (OSC48_17165) | 3764091..3764867 | - | 777 | WP_266246104.1 | amino acid ABC transporter permease | - |
| OSC48_RS17170 (OSC48_17170) | 3764879..3765685 | - | 807 | WP_266246106.1 | ABC transporter substrate-binding protein | - |
| OSC48_RS17175 (OSC48_17175) | 3765747..3766415 | - | 669 | WP_253508486.1 | GntR family transcriptional regulator | - |
| OSC48_RS17180 (OSC48_17180) | 3766499..3766807 | - | 309 | WP_266246108.1 | hypothetical protein | - |
| OSC48_RS17185 (OSC48_17185) | 3767006..3767431 | + | 426 | WP_253508488.1 | hypothetical protein | - |
| OSC48_RS17190 (OSC48_17190) | 3767483..3767800 | - | 318 | WP_034099046.1 | transcriptional regulator | - |
| OSC48_RS17195 (OSC48_17195) | 3768197..3768484 | + | 288 | WP_181081261.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OSC48_RS17200 (OSC48_17200) | 3768474..3768761 | + | 288 | WP_266246111.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSC48_RS17205 (OSC48_17205) | 3768800..3769576 | - | 777 | WP_266246113.1 | DUF1828 domain-containing protein | - |
| OSC48_RS17210 (OSC48_17210) | 3769576..3770091 | - | 516 | WP_266246114.1 | hypothetical protein | - |
| OSC48_RS17215 (OSC48_17215) | 3770136..3770372 | - | 237 | WP_266246115.1 | hypothetical protein | - |
| OSC48_RS17220 (OSC48_17220) | 3770628..3770849 | + | 222 | WP_266246116.1 | hypothetical protein | - |
| OSC48_RS17225 (OSC48_17225) | 3770899..3771123 | + | 225 | WP_266246118.1 | Arc family DNA-binding protein | - |
| OSC48_RS17230 (OSC48_17230) | 3771120..3771287 | + | 168 | WP_266246119.1 | hypothetical protein | - |
| OSC48_RS17235 (OSC48_17235) | 3771280..3771627 | + | 348 | WP_266246121.1 | hypothetical protein | - |
| OSC48_RS17240 (OSC48_17240) | 3771920..3773104 | + | 1185 | WP_266246122.1 | tyrosine-type recombinase/integrase | - |
| OSC48_RS17250 (OSC48_17250) | 3773354..3773710 | - | 357 | WP_003174972.1 | MerR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10987.84 Da Isoelectric Point: 10.2255
>T264895 WP_266246111.1 NZ_CP112867:3768474-3768761 [Pseudomonas quebecensis]
MAAEYEVEWDPKALKELRKLDGTIRLQFLKKLQERQSGPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDERIVILVLAV
GKRERGSVYEQAGKR
MAAEYEVEWDPKALKELRKLDGTIRLQFLKKLQERQSGPRVPGDALHGMKDCYKIKLRGAGYRLVYRVEDERIVILVLAV
GKRERGSVYEQAGKR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|