Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 449118..449773 | Replicon | chromosome |
| Accession | NZ_CP111136 | ||
| Organism | Burkholderia pseudomallei strain MSHR7744 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OSB53_RS02270 | Protein ID | WP_004521942.1 |
| Coordinates | 449477..449773 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q63YL3 |
| Locus tag | OSB53_RS02265 | Protein ID | WP_004202809.1 |
| Coordinates | 449118..449474 (-) | Length | 119 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OSB53_RS02235 (OSB53_02235) | 445244..446002 | + | 759 | WP_004521940.1 | cytochrome c1 | - |
| OSB53_RS02240 (OSB53_02240) | 446095..446706 | + | 612 | WP_004185176.1 | glutathione S-transferase N-terminal domain-containing protein | - |
| OSB53_RS02245 (OSB53_02245) | 446776..447303 | + | 528 | WP_004521941.1 | ClpXP protease specificity-enhancing factor | - |
| OSB53_RS02255 (OSB53_02255) | 447639..448022 | + | 384 | WP_044584020.1 | terminase | - |
| OSB53_RS02260 (OSB53_02260) | 448019..449074 | + | 1056 | WP_004557286.1 | phage portal protein | - |
| OSB53_RS02265 (OSB53_02265) | 449118..449474 | - | 357 | WP_004202809.1 | putative addiction module antidote protein | Antitoxin |
| OSB53_RS02270 (OSB53_02270) | 449477..449773 | - | 297 | WP_004521942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OSB53_RS02275 (OSB53_02275) | 450441..451697 | + | 1257 | WP_004552667.1 | AAA family ATPase | - |
| OSB53_RS02280 (OSB53_02280) | 451742..452317 | + | 576 | WP_198014201.1 | DUF4276 family protein | - |
| OSB53_RS02285 (OSB53_02285) | 453071..453415 | + | 345 | WP_004535737.1 | hypothetical protein | - |
| OSB53_RS02290 (OSB53_02290) | 453408..453819 | + | 412 | Protein_445 | phage tail protein I | - |
| OSB53_RS02295 (OSB53_02295) | 453858..454319 | + | 462 | WP_232290550.1 | DNA methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 447708..455775 | 8067 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 10902.68 Da Isoelectric Point: 9.9369
>T264869 WP_004521942.1 NZ_CP111136:c449773-449477 [Burkholderia pseudomallei]
MFKVLTTPQFDKWLDGLRDPVGSAAINLRIERAKLGNLGQWRAVGDGVNEMKIDVGPGYRAYFVRRGKIIVVVLCGGDKS
TQKKDIKLAKQIADELED
MFKVLTTPQFDKWLDGLRDPVGSAAINLRIERAKLGNLGQWRAVGDGVNEMKIDVGPGYRAYFVRRGKIIVVVLCGGDKS
TQKKDIKLAKQIADELED
Download Length: 297 bp
Antitoxin
Download Length: 119 a.a. Molecular weight: 12585.41 Da Isoelectric Point: 9.9470
>AT264869 WP_004202809.1 NZ_CP111136:c449474-449118 [Burkholderia pseudomallei]
MKISELAEFDGSKYLKDEETIRHYLAQAFEDGNPRLIQAALGNVAKARGMTALARESGVKREALYRALSEGGNAEFATIM
KVVGALGLHLTVAPAEPAPVPAPATTRARSRVRTAAHA
MKISELAEFDGSKYLKDEETIRHYLAQAFEDGNPRLIQAALGNVAKARGMTALARESGVKREALYRALSEGGNAEFATIM
KVVGALGLHLTVAPAEPAPVPAPATTRARSRVRTAAHA
Download Length: 357 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|