Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3991599..3991821 | Replicon | chromosome |
| Accession | NZ_CP111008 | ||
| Organism | Escherichia coli strain J53-p130 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | ORI87_RS19565 | Protein ID | WP_000141634.1 |
| Coordinates | 3991599..3991706 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3991755..3991821 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI87_RS19540 | 3986852..3987580 | - | 729 | WP_011310329.1 | cellulose biosynthesis protein BcsQ | - |
| ORI87_RS19545 | 3987616..3987804 | - | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
| ORI87_RS19550 | 3988077..3989648 | + | 1572 | WP_001204931.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| ORI87_RS19555 | 3989645..3989836 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| ORI87_RS19560 | 3989833..3991512 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| ORI87_RS19565 | 3991599..3991706 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 3991755..3991821 | + | 67 | - | - | Antitoxin |
| ORI87_RS19570 | 3992182..3993453 | + | 1272 | WP_001295225.1 | aromatic amino acid transport family protein | - |
| ORI87_RS19575 | 3993483..3994487 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| ORI87_RS19580 | 3994484..3995467 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| ORI87_RS19585 | 3995478..3996380 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T264793 WP_000141634.1 NZ_CP111008:c3991706-3991599 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT264793 NZ_CP111008:3991755-3991821 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|