Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4171888..4172507 Replicon chromosome
Accession NZ_CP110967
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-424/19

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NPX97_RS20795 Protein ID WP_002892050.1
Coordinates 4172289..4172507 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NPX97_RS20790 Protein ID WP_002892066.1
Coordinates 4171888..4172262 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX97_RS20780 (NPX97_20780) 4167040..4168233 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NPX97_RS20785 (NPX97_20785) 4168256..4171402 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NPX97_RS20790 (NPX97_20790) 4171888..4172262 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NPX97_RS20795 (NPX97_20795) 4172289..4172507 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NPX97_RS20800 (NPX97_20800) 4172666..4173232 + 567 WP_002892030.1 maltose O-acetyltransferase -
NPX97_RS20805 (NPX97_20805) 4173204..4173344 - 141 WP_004147370.1 hypothetical protein -
NPX97_RS20810 (NPX97_20810) 4173365..4173835 + 471 WP_002892026.1 YlaC family protein -
NPX97_RS20815 (NPX97_20815) 4173810..4175261 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NPX97_RS20820 (NPX97_20820) 4175362..4176060 + 699 WP_002892021.1 GNAT family protein -
NPX97_RS20825 (NPX97_20825) 4176057..4176197 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NPX97_RS20830 (NPX97_20830) 4176197..4176460 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T264630 WP_002892050.1 NZ_CP110967:4172289-4172507 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT264630 WP_002892066.1 NZ_CP110967:4171888-4172262 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References