Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 14744..15369 Replicon plasmid unnamed2
Accession NZ_CP110933
Organism Salmonella enterica strain XM3104

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag ORG44_RS23900 Protein ID WP_000911322.1
Coordinates 14971..15369 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8F2UQ48
Locus tag ORG44_RS23895 Protein ID WP_000450263.1
Coordinates 14744..14971 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORG44_RS23865 (ORG44_23865) 10013..10182 - 170 Protein_12 phospholipase -
ORG44_RS23870 (ORG44_23870) 10233..10430 - 198 WP_223155440.1 hypothetical protein -
ORG44_RS23875 (ORG44_23875) 10404..10677 - 274 Protein_14 disulfide bond formation protein DsbA -
ORG44_RS23880 (ORG44_23880) 10794..11357 - 564 WP_000139307.1 fertility inhibition protein FinO -
ORG44_RS23885 (ORG44_23885) 11412..12152 - 741 WP_000177630.1 conjugal transfer pilus acetylase TraX -
ORG44_RS23890 (ORG44_23890) 12172..14662 - 2491 Protein_17 conjugative relaxase -
ORG44_RS23895 (ORG44_23895) 14744..14971 + 228 WP_000450263.1 toxin-antitoxin system antitoxin VapB Antitoxin
ORG44_RS23900 (ORG44_23900) 14971..15369 + 399 WP_000911322.1 type II toxin-antitoxin system VapC family toxin Toxin
ORG44_RS23905 (ORG44_23905) 15378..17567 - 2190 WP_079961212.1 type IV conjugative transfer system coupling protein TraD -
ORG44_RS23910 (ORG44_23910) 17939..18670 - 732 WP_001541558.1 conjugal transfer complement resistance protein TraT -
ORG44_RS23915 (ORG44_23915) 18973..19215 - 243 WP_024131413.1 hypothetical protein -
ORG44_RS23920 (ORG44_23920) 19212..19913 - 702 WP_148201696.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefB / pefA / pefC / pefD / spvB / spvC 1..49544 49544


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14887.13 Da        Isoelectric Point: 8.5264

>T264507 WP_000911322.1 NZ_CP110933:14971-15369 [Salmonella enterica]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8532.53 Da        Isoelectric Point: 4.7513

>AT264507 WP_000450263.1 NZ_CP110933:14744-14971 [Salmonella enterica]
METSVFLSNRSQAVRLPKAVALPEHVKRVEVIAVGRTRIITPAGESWDEWFDGNNVSADFMDNREQPSVQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References