Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4558340..4558942 | Replicon | chromosome |
| Accession | NZ_CP110931 | ||
| Organism | Salmonella enterica strain XM3104 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | ORG44_RS22330 | Protein ID | WP_001159630.1 |
| Coordinates | 4558631..4558942 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ORG44_RS22325 | Protein ID | WP_000362050.1 |
| Coordinates | 4558340..4558630 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG44_RS22310 (4555833) | 4555833..4556735 | + | 903 | WP_001541228.1 | formate dehydrogenase subunit beta | - |
| ORG44_RS22315 (4556732) | 4556732..4557367 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| ORG44_RS22320 (4557364) | 4557364..4558293 | + | 930 | WP_001541226.1 | formate dehydrogenase accessory protein FdhE | - |
| ORG44_RS22325 (4558340) | 4558340..4558630 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| ORG44_RS22330 (4558631) | 4558631..4558942 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| ORG44_RS22335 (4559160) | 4559160..4560075 | + | 916 | Protein_4362 | alpha/beta hydrolase | - |
| ORG44_RS22340 (4560089) | 4560089..4561030 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| ORG44_RS22345 (4561075) | 4561075..4561512 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| ORG44_RS22350 (4561509) | 4561509..4562381 | - | 873 | WP_023235429.1 | virulence factor BrkB family protein | - |
| ORG44_RS22355 (4562375) | 4562375..4562974 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T264506 WP_001159630.1 NZ_CP110931:c4558942-4558631 [Salmonella enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|