Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4128351..4128867 | Replicon | chromosome |
| Accession | NZ_CP110931 | ||
| Organism | Salmonella enterica strain XM3104 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | ORG44_RS20325 | Protein ID | WP_000220578.1 |
| Coordinates | 4128351..4128635 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | ORG44_RS20330 | Protein ID | WP_000212724.1 |
| Coordinates | 4128625..4128867 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG44_RS20310 (4123471) | 4123471..4125119 | + | 1649 | Protein_3974 | alpha,alpha-phosphotrehalase | - |
| ORG44_RS20315 (4125528) | 4125528..4127666 | + | 2139 | WP_001541406.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| ORG44_RS20320 (4127883) | 4127883..4128347 | + | 465 | WP_001009177.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| ORG44_RS20325 (4128351) | 4128351..4128635 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ORG44_RS20330 (4128625) | 4128625..4128867 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| ORG44_RS20335 (4128945) | 4128945..4130878 | - | 1934 | Protein_3979 | BglG family transcription antiterminator | - |
| ORG44_RS20340 (4130895) | 4130895..4131635 | - | 741 | WP_000779257.1 | KDGP aldolase family protein | - |
| ORG44_RS20345 (4131632) | 4131632..4132750 | - | 1119 | WP_038394077.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| ORG44_RS20350 (4132734) | 4132734..4133867 | - | 1134 | WP_000459940.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T264505 WP_000220578.1 NZ_CP110931:c4128635-4128351 [Salmonella enterica]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |