Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3368392..3369012 | Replicon | chromosome |
| Accession | NZ_CP110931 | ||
| Organism | Salmonella enterica strain XM3104 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | ORG44_RS16660 | Protein ID | WP_001280991.1 |
| Coordinates | 3368794..3369012 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | ORG44_RS16655 | Protein ID | WP_000344807.1 |
| Coordinates | 3368392..3368766 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG44_RS16645 (3363531) | 3363531..3364724 | + | 1194 | WP_023235518.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| ORG44_RS16650 (3364747) | 3364747..3367896 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| ORG44_RS16655 (3368392) | 3368392..3368766 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| ORG44_RS16660 (3368794) | 3368794..3369012 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| ORG44_RS16665 (3369191) | 3369191..3369742 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| ORG44_RS16670 (3369860) | 3369860..3370330 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| ORG44_RS16675 (3370386) | 3370386..3370526 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| ORG44_RS16680 (3370532) | 3370532..3370792 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| ORG44_RS16685 (3371017) | 3371017..3372426 | + | 1410 | WP_038393950.1 | EAL domain-containing protein | - |
| ORG44_RS16695 (3372657) | 3372657..3373046 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| ORG44_RS16700 (3373079) | 3373079..3373648 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T264502 WP_001280991.1 NZ_CP110931:3368794-3369012 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT264502 WP_000344807.1 NZ_CP110931:3368392-3368766 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|