Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 301740..302531 | Replicon | chromosome |
| Accession | NZ_CP110931 | ||
| Organism | Salmonella enterica strain XM3104 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | C0Q119 |
| Locus tag | ORG44_RS01365 | Protein ID | WP_000369560.1 |
| Coordinates | 302013..302531 (+) | Length | 173 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | Q57IR1 |
| Locus tag | ORG44_RS01360 | Protein ID | WP_001275017.1 |
| Coordinates | 301740..302009 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG44_RS01340 (297321) | 297321..297989 | + | 669 | WP_000617729.1 | cell division ATP-binding protein FtsE | - |
| ORG44_RS01345 (297982) | 297982..299037 | + | 1056 | WP_001079363.1 | permease-like cell division protein FtsX | - |
| ORG44_RS01350 (299283) | 299283..300137 | + | 855 | WP_000159621.1 | RNA polymerase sigma factor RpoH | - |
| ORG44_RS01355 (300459) | 300459..301562 | + | 1104 | WP_001535347.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| ORG44_RS01360 (301740) | 301740..302009 | + | 270 | WP_001275017.1 | DUF1778 domain-containing protein | Antitoxin |
| ORG44_RS01365 (302013) | 302013..302531 | + | 519 | WP_000369560.1 | GNAT family N-acetyltransferase | Toxin |
| ORG44_RS01370 (302528) | 302528..302911 | - | 384 | WP_000778873.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| ORG44_RS01375 (303333) | 303333..304436 | + | 1104 | WP_023235350.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| ORG44_RS01380 (304496) | 304496..305422 | + | 927 | WP_000003005.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| ORG44_RS01385 (305419) | 305419..306696 | + | 1278 | WP_001541045.1 | branched chain amino acid ABC transporter permease LivM | - |
| ORG44_RS01390 (306693) | 306693..307460 | + | 768 | WP_000082080.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19414.16 Da Isoelectric Point: 8.9619
>T264492 WP_000369560.1 NZ_CP110931:302013-302531 [Salmonella enterica]
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
VDNLTIEILADNAEYNWRQFDCGEASLNLFLTQHLQRQHNNKILRGYVLRTTTPERRVLGYYTLSGSCFERASLPSRTQQ
KRIPYQNIPSVTLGRLAVDLSLQGKGWGAILVTHAMKVVWSASLAVGIHGIFVEALNEKAQAFYQRLGFISLSGENEHAL
FYPTKSIEQLFG
Download Length: 519 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5BA59 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I8URP5 |