Detailed information of TA system TA264458

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /HTH_19(antitoxin)
• Location: 438388..439215
• Replicon: chromosome
• Accession: NZ_CP110889
• Organism: Thermoclostridium stercorarium strain RKWS1

Toxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: ODU73_RS01955
• Protein ID: WP_265976455.1
• Coordinates: 438388..438852 (-)
• Length: 155 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: ODU73_RS01960
• Protein ID: WP_265976456.1
• Coordinates: 438874..439215 (-)
• Length: 114 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ODU73_RS01920 (ODU73_000384)	433393..433557	-	165	WP_265976454.1	helix-turn-helix domain-containing protein	-
ODU73_RS01925 (ODU73_000385)	433765..433917	+	153	Protein_376	IS30 family transposase	-
ODU73_RS01930 (ODU73_000386)	433926..435152	-	1227	WP_015358103.1	IS256 family transposase	-
ODU73_RS01935 (ODU73_000387)	435212..435397	+	186	Protein_378	IS30 family transposase	-
ODU73_RS01940 (ODU73_000388)	435585..436655	+	1071	WP_003511744.1	IS30-like element ISCth3 family transposase	-
ODU73_RS01950 (ODU73_000390)	437166..438383	-	1218	WP_015358104.1	tyrosine-type recombinase/integrase	-
ODU73_RS01955 (ODU73_000391)	438388..438852	-	465	WP_265976455.1	ImmA/IrrE family metallo-endopeptidase	Toxin
ODU73_RS01960 (ODU73_000392)	438874..439215	-	342	WP_265976456.1	helix-turn-helix transcriptional regulator	Antitoxin
ODU73_RS01965 (ODU73_000393)	439362..439640	+	279	WP_265976457.1	helix-turn-helix domain-containing protein	-
ODU73_RS01970 (ODU73_000394)	439601..439795	+	195	WP_265976458.1	helix-turn-helix domain-containing protein	-
ODU73_RS01975 (ODU73_000395)	439834..440616	+	783	WP_265976459.1	phage antirepressor N-terminal domain-containing protein	-
ODU73_RS01980 (ODU73_000396)	440629..440805	+	177	WP_265976460.1	hypothetical protein	-
ODU73_RS01985 (ODU73_000397)	440977..441150	+	174	WP_265976461.1	hypothetical protein	-
ODU73_RS01990 (ODU73_000398)	441147..441374	-	228	WP_265976462.1	hypothetical protein	-
ODU73_RS01995 (ODU73_000399)	441442..442011	+	570	WP_265976463.1	hypothetical protein	-
ODU73_RS02000 (ODU73_000400)	442008..442757	+	750	WP_265976464.1	phage antirepressor KilAC domain-containing protein	-
ODU73_RS02005 (ODU73_000401)	442754..442921	+	168	WP_265976465.1	zinc-ribbon domain containing protein	-
ODU73_RS02010 (ODU73_000402)	442914..443093	+	180	WP_265976466.1	hypothetical protein	-
ODU73_RS02015 (ODU73_000403)	443151..444092	+	942	WP_265976467.1	YqaJ viral recombinase family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Prophage	-	-	433926..476130	42204

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• IrrE N-terminal-like domain (14-120)

Antitoxin

• Cro/C1-type helix-turn-helix domain (4-62)

Sequences

Toxin

Protein

• Length: 155 a.a.
• Molecular weight: 18020.65 Da
• Isoelectric Point: 7.3481

>T264458 WP_265976455.1 NZ_CP110889:c438852-438388 [Thermoclostridium stercorarium]
MLYEFLLIKADNEGINVYEKEIGKLKGLYFDGNIIINSSIETNSEKACILAEELGHHYTTHGNILNQCKVENRKQERRAR
AWAYERLVSLNSLIEASKHGIRNRFELAEFLGVSERFIDEAIQYYKEKYGICHKVRDYIVYFEPLGVLKKVQKE

Nucleotide

• Length: 465 bp

Antitoxin

Protein

• Length: 114 a.a.
• Molecular weight: 12874.82 Da
• Isoelectric Point: 8.3707

>AT264458 WP_265976456.1 NZ_CP110889:c439215-438874 [Thermoclostridium stercorarium]
MAIGDRIKKLRMEKGMTQEELAKYIDSTKQTIYKYENNIVTNIPSDKIEKIAEALGTTPSYLMGWNDTASKNNVKKPITV
AAHIPDGVELTEEDIKQINDFIQFIISKKKDQK

Nucleotide

• Length: 342 bp